Clostridium FliD Recombinant Protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameClostridium FliD Recombinant Protein
Uniprot IDQ18CX9
Uniprot linkhttp://www.uniprot.org/uniprot/Q18CX9
Origin speciesClostridium
Expression systemProcaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMSSISPVRV TGLSGNFDMEGIIEASMIRDKEKVNKAKQDQQIVKWKQEIYRDIIKESKNLYDKYLNGDSPNSITNKKAYSATRITSSDE SIIVAKGSAGAEKINYQFAVSQMAEPAKVTIKLNSSDPIVQQFPPNASGASSLNIGGVNIPISEQDTTSTIVSKINSLCA DNDIRASYSEMTGELIISRKQTGSSSDIDLKVIGNDSLAGQIASDNGITFTTDASGTKSAVVYGKNLEADVTDDQGRVTH ISKEQNSFKIDNIDYNVNSKGSAKLVSVTDTEEATKNMKAFVDDYNALMDKVYGLVTTKKSKDYPPLTDEQKDDMTTEEI EKWEKKAKEGILRNDDELRAFVEDIQSMFFGDADTIIALRKLGISEHENYNKKGQISFNADTFSKALIDDSDKVYKALAG YSSNYDDKGMFEKLKKIVFEYSGSSASKLTKKAGMENSSSASQNVYSKQIAEQERNISRLVEKMNDKEKRLYAKYSALES LLNKYSSQMNYFSQAQGN
Molecular weight82,79 kDa
Protein delivered with Tag?No
Purity estimated80%
Buffer3C-protease cleavage buffer: TrisHC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionYP_001086705.1
Spec:Entrez GeneID4916755
Spec:SwissProtIDQ18CX9
NCBI ReferenceYP_001086705.1
Aliases /SynonymsFliD, flagellar cap protein FliD
ReferencePX-P1051
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Clostridium FliD Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.