Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Clostridium Cwp84 Recombinant Protein |
|---|---|
| Uniprot ID | Q183M1 |
| Uniprot link | http://www.uniprot.org/uniprot/Q183M1 |
| Origin species | Clostridium |
| Expression system | Prokaryotic expression |
| Sequence | MGSSHHHHHHSSGLVPRGSHMASAENHKTLDGVETAEYSESYLQYLEDVKNGDTAKYNGVIPFPHEMEGTTLRNKGRSSL PSAYKSSVAYNPMDLGLTTPAKNQGSLNTCWSFSGMSTLEAYLKLKGYGTYDLSEEHLRWWATGGKYGWNLDDMSGSSNV TAIGYLTAWAGPKLEKDIPYNLKSEAQGATKPSNMDTAPTQFNVTDVVRLNKDKETVKNAIMQYGSVTSGYAHYSTYFNK DETAYNCTNKRAPLNHAVAIVGWDDNYSKDNFASDVKPESNGAWLVKSSWGEFNSMKGFFWISYEDKTLLTDTDNYAMKS VSKPDSDKKMYQLEYAGLSKIMSNKVTAANVFDFSRDSEKLDSVMFETDSVGAKYEVYYAPVVNGVPQNNSMTKLASGTV SYSGYINVPTNSYSLPKGKGAIVVVIDNTANPNREKSTLAYETNIDAYYLYEAKANLGESYILQNNKFEDINTYSEFSPC NFVIKAITKTSSGQATSGESLTGADRYETAVKVSQKGWTSSQNAVLVNGDAIVDALTATPFTAAIDSPILLTGKDNLDSK TKAELQRLGTKKVYLIGGENSLSKNVQTQLSNMGISVERISGSDRYKTSISLAQKLNSIKSVSQVAVANGVNGLADAISV GAAAADNNMPIILTNEKSELQGADEFLNSSKITKSYIIGGTATLSSNLESKLSNPTRLAGSNRNETNAKIIDKFYPSSDL KYAFVVKDGSKSQGDLIDGLAVGALGAKTDSPVVLVGNKLDESQKNVLKSKKIETPIRVGGNGNESAFNELNTLLGK |
| Molecular weight | 83,36 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 60% |
| Buffer | PBS, imidazole 300mM |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | YP_001089300.1 |
| Spec:Entrez GeneID | 4915160 |
| Spec:SwissProtID | Q183M1 |
| NCBI Reference | YP_001089300.1 |
| Aliases /Synonyms | Cwp84, cell surface-associated cysteine protease, CD630_27870 |
| Reference | PX-P1083 |
| Note | For research use only |
Cwp84 is a Clostridium. difficile surface protein that has recently been shown to possess cysteine protease activity and which is highly immunogenic in patients with C. difficile-associated disease and is likely implicated in the pathogenic process and may have a role in the degradation of extracellular matrices. This enzyme, which appears to be displayed on the bacterial cell surface, exhibited degrading activity against fibronectin, laminin, and vitronectin. Cwp84 plays also a role in maturation of SlpA.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.