Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Clostridium chauvoei CCTA-His Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Clostridium chauvoei
Uniprot ID:
I6VBE8
Molecular weight:
33.9kDa

Original price was: €242.00.Current price is: €210.00.

50ug 13% OFF + 210 loyalty points
Partial His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Clostridium chauvoei CCTA-His Recombinant Protein

Product name Clostridium chauvoei CCTA-His Recombinant Protein
Uniprot ID I6VBE8
Uniprot link http://www.uniprot.org/uniprot/I6VBE8
Origin species Clostridium chauvoei
Expression system Prokaryotic expression
Raw Antigen Sequence MNHKVHHHHHHMQENTCIVETPSEGVKTFTSSDTAYADYNCFKTNLSVTFIEDQHNNQLT ALVSTEGSFIPSGLSRVGGYYQADMYWPSKYYTTLTTYDRNNRVKITKSIPTNQIDTVSV SETMGYSIGGSLSIEYGKEGPKAGGGINGSYTAQRSVTYDQPDYRTLLMKDSVNSASWEV AFNATKDGYDRDSYHGIYGNQLFMRYRLYNTGINNLTTDNNLSSLIVGGFSPKVVIALTA PKGTEESTVKVEYNRFNDQYRLRWSGTEWYGENNRNSRIDSSSESFILNWKNHTVEHAGY
Molecular weight 33.9kDa
Protein delivered with Tag? His
Purity estimated 90%
Buffer PBS pH 7.5, 4 M urea
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-47% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CDG01028
Spec:SwissProtID S6F7P4
NCBI Reference CDG01028
Reference PX-P4067
Note For research use only
Molecular Constructor
Partial His
Product name Clostridium chauvoei CCTA-His Recombinant Protein
Uniprot ID I6VBE8
Uniprot link http://www.uniprot.org/uniprot/I6VBE8
Origin species Clostridium chauvoei
Expression system Prokaryotic expression
Raw Antigen Sequence MNHKVHHHHHHMQENTCIVETPSEGVKTFTSSDTAYADYNCFKTNLSVTFIEDQHNNQLT ALVSTEGSFIPSGLSRVGGYYQADMYWPSKYYTTLTTYDRNNRVKITKSIPTNQIDTVSV SETMGYSIGGSLSIEYGKEGPKAGGGINGSYTAQRSVTYDQPDYRTLLMKDSVNSASWEV AFNATKDGYDRDSYHGIYGNQLFMRYRLYNTGINNLTTDNNLSSLIVGGFSPKVVIALTA PKGTEESTVKVEYNRFNDQYRLRWSGTEWYGENNRNSRIDSSSESFILNWKNHTVEHAGY
Molecular weight 33.9kDa
Protein delivered with Tag? His
Purity estimated 90%
Buffer PBS pH 7.5, 4 M urea
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-47% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CDG01028
Spec:SwissProtID S6F7P4
NCBI Reference CDG01028
Reference PX-P4067
Note For research use only
Molecular Constructor
Partial His
Product name PX-P4067-1MG
Uniprot ID I6VBE8
Uniprot link http://www.uniprot.org/uniprot/I6VBE8
Origin species Clostridium chauvoei
Expression system Prokaryotic expression
Raw Antigen Sequence MNHKVHHHHHHMQENTCIVETPSEGVKTFTSSDTAYADYNCFKTNLSVTFIEDQHNNQLT ALVSTEGSFIPSGLSRVGGYYQADMYWPSKYYTTLTTYDRNNRVKITKSIPTNQIDTVSV SETMGYSIGGSLSIEYGKEGPKAGGGINGSYTAQRSVTYDQPDYRTLLMKDSVNSASWEV AFNATKDGYDRDSYHGIYGNQLFMRYRLYNTGINNLTTDNNLSSLIVGGFSPKVVIALTA PKGTEESTVKVEYNRFNDQYRLRWSGTEWYGENNRNSRIDSSSESFILNWKNHTVEHAGY
Molecular weight 33.9kDa
Protein delivered with Tag? His
Purity estimated 90%
Buffer PBS pH 7.5, 4 M urea
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-47% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CDG01028
Spec:SwissProtID S6F7P4
NCBI Reference CDG01028
Reference PX-P4067
Note For research use only
Molecular Constructor
Partial His

About CCTA: a secreted toxin

CCTA ( Clostridium chauvoei Toxin A) is an exotoxin from the Beta-barrel family of pore and is part of the leucocidin toxin superfamily. It is a α-hemolysin secreted by C. chauvoei ) (anaerobic gram positive bacillus, which is transmitted by spores) and also is a major factor of virulence of a soil borne zoonose: the blackleg disease in humans and domestic animals, especially ruminants. It produces cytolysis in tissues, hemolysis in the erythrocytes, oedemic lesions, and necrosis of the skin and a release of cytokines which is causing inflammation shock. Blackleg disease is controlled by vaccines composed of the whole inactivated bacteria. But it appears that the protective immunity may be linked to CCTA, as it is a protective antigen against muscular gas gangrene among humans.

A product for your experiences

CCTA-His recombinant protein is designed to be extracted and purified the easiest way from cell lysates. This exotoxin is fused with the N-terminal His Tag and is expressed in E. coli. This recombinant product could be used in research about immunity and to highlight some mechanism of actions.
Proteogenix offers this recombinant product to help research in immunology and toxicology. It can also be used to improve the knowledge about the leucocidin toxin superfamily. Research used only.

Clostridium chauvoei CCTA-His Recombinant Protein

There are no reviews yet.

Be the first to review “Clostridium chauvoei CCTA-His Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products