Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Citatuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade

  • PX-TA1170-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
Fab-G1-kappa

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Citatuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

Product name Citatuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade
Uniprot ID P16422
Source CAS 945228-49-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Citatuzumab,VB6-845,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1170
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-kappa
Clonality Monoclonal Antibody
Product name Citatuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade
Uniprot ID P16422
Source CAS 945228-49-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Citatuzumab,VB6-845,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1170
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1170-50
Uniprot ID P16422
Source CAS 945228-49-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Citatuzumab,VB6-845,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1170
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-kappa
Clonality Monoclonal Antibody

Citatuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade: A Potent Antibody Targeting EPCAM for

Cancer Therapy Introduction

Citatuzumab Biosimilar, also known as Anti-EPCAM, CD326 mAb, is a monoclonal antibody that specifically targets the Epithelial Cell Adhesion Molecule (EPCAM). This biosimilar is a research-grade version of the original citatuzumab antibody, which has shown promising results in clinical trials for the treatment of various types of cancer. In this article, we will explore the structure, activity, and potential applications of this potent antibody.

Structure of Citatuzumab Biosimilar

Citatuzumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to its target, EPCAM, while the constant region mediates effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Citatuzumab Biosimilar

The primary mechanism of action of citatuzumab biosimilar is its ability to bind to EPCAM, a transmembrane glycoprotein that is overexpressed in many types of cancer cells. This binding leads to the activation of downstream signaling pathways, resulting in cell death and inhibition of cancer growth. In addition, citatuzumab biosimilar also mediates ADCC and CDC, which further enhance its anti-tumor activity.

Therapeutic Applications

Citatuzumab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various types of cancer, including colorectal, pancreatic, and breast cancer. In a phase II clinical trial, citatuzumab biosimilar in combination with chemotherapy showed a significant improvement in progression-free survival and overall survival in patients with metastatic colorectal cancer. It has also shown potential as a neoadjuvant therapy for pancreatic cancer, with a high rate of tumor shrinkage observed in a phase Ib clinical trial.

In addition to its direct anti-tumor activity, citatuzumab biosimilar has also been investigated for its potential use in cancer imaging and targeted drug delivery. Studies have shown that the antibody can be labeled with radioisotopes or fluorescent dyes, allowing for the visualization of EPCAM-expressing tumors. This could aid in the diagnosis and monitoring of cancer, as well as in the selection of patients who are likely to respond to citatuzumab biosimilar treatment.

Conclusion

Citatuzumab Biosimilar, also known as Anti-EPCAM, CD326 mAb, is a potent monoclonal antibody that specifically targets EPCAM, a protein that is overexpressed in many types of cancer. Its unique structure and mechanism of action make it a promising therapeutic agent for the treatment of various cancers. In addition, its potential use in cancer imaging and targeted drug delivery further expands its applications in the field of oncology. Further research and clinical trials are needed to fully explore the potential of citatuzumab biosimilar in cancer therapy.

Citatuzumab Biosimilar - Anti-CD326,EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Citatuzumab Biosimilar - Anti-CD326,EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Immobilized Human CD326-EPCAM recombinant protein (cat. No.PX-P6119) at 0.5µg/mL (100µL/well) can bind Citatuzumab Biosimilar - Anti-CD326,EPCAM mAb - Research Grade (cat. No.PX-TA1170) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 242.66M.

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow-cytometry using PE anti-human CD326 antibody. HT-29 cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human CD326 monoclonal antibody (Catalog: PX-TA1170, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow-cytometry using APC anti-human CD326 antibody. HT-29 cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human CD326 monoclonal antibody (Catalog: PX-TA1170, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow-cytometry using FITC anti-human CD326 antibody. HT-29 cells were stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human CD326 monoclonal antibody (Catalog: PX-TA1170, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Citatuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

There are no reviews yet.

Be the first to review “Citatuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products