Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Ciona intestinalis Tropomyosin Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Ciona intestinalis
Uniprot ID:
Q9NDQ4
Molecular weight:
29,53 kDa

€210.00

50ug + 210 loyalty points
Full-length Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Ciona intestinalis Tropomyosin Recombinant Protein

Ciona intestinalis Tropomyosin Recombinant Protein

Product name Ciona intestinalis Tropomyosin Recombinant Protein
Uniprot ID Q9NDQ4
Uniprot link http://www.uniprot.org/uniprot/Q9NDQ4
Origin species Ciona intestinalis
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMENIKMKIAKLKAESDEKENQICDLSDQLKKVTEERKQFEEVNRSLSNKISTNDTDIERLELQNEELKR KSENAERELDEVQRELKKLQSEHTASAERCDDLTEELKLRKMDLDEVTTNYDDAMRRIKVLDGDNCRLDDKVQALEDEAK QLRESGQDMDGILKALEAKETTYGNNEIQAEDQIRSLKMALEESECRREALENEAKKYQADIEKLELDLDKEMAEKEEAK AELDRVLSELGEM VQRELKKLQSEHTASAERCDDLTEELKLRKMDLDEVTTNYDDAMRRIKVLDGDNCRLDDKVQALEDEAKQLRESGQDMDG ILKALEAKETTYGNNEIQAEDQIRSLKMALEESECRREALENEAKKYQADIEKLELDLDKEMAEKEEAKAELDRVLSELG EM
Molecular weight 29,53 kDa
Protein delivered with Tag? Yes
Purity estimated >90% (for both)
Buffer PBS, imidazole 300mM, pH7,4 in natives conditions, PBS, Urea 8M, imidazole 10mM, pH4,5 in denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_001027603.1
Spec:Entrez GeneID 445601
Spec:NCBI Gene Aliases Ci-tropm1, trop, MYH11
Spec:SwissProtID Q9NDQ4
NCBI Reference NP_001027603.1
Aliases /Synonyms Tropomyosin, tropomyosin-like protein
Reference PX-P1056
Note For research use only
Molecular Constructor
Full-length Yes
Product name Ciona intestinalis Tropomyosin Recombinant Protein
Uniprot ID Q9NDQ4
Uniprot link http://www.uniprot.org/uniprot/Q9NDQ4
Origin species Ciona intestinalis
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMENIKMKIAKLKAESDEKENQICDLSDQLKKVTEERKQFEEVNRSLSNKISTNDTDIERLELQNEELKR KSENAERELDEVQRELKKLQSEHTASAERCDDLTEELKLRKMDLDEVTTNYDDAMRRIKVLDGDNCRLDDKVQALEDEAK QLRESGQDMDGILKALEAKETTYGNNEIQAEDQIRSLKMALEESECRREALENEAKKYQADIEKLELDLDKEMAEKEEAK AELDRVLSELGEM VQRELKKLQSEHTASAERCDDLTEELKLRKMDLDEVTTNYDDAMRRIKVLDGDNCRLDDKVQALEDEAKQLRESGQDMDG ILKALEAKETTYGNNEIQAEDQIRSLKMALEESECRREALENEAKKYQADIEKLELDLDKEMAEKEEAKAELDRVLSELG EM
Molecular weight 29,53 kDa
Protein delivered with Tag? Yes
Purity estimated >90% (for both)
Buffer PBS, imidazole 300mM, pH7,4 in natives conditions, PBS, Urea 8M, imidazole 10mM, pH4,5 in denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_001027603.1
Spec:Entrez GeneID 445601
Spec:NCBI Gene Aliases Ci-tropm1, trop, MYH11
Spec:SwissProtID Q9NDQ4
NCBI Reference NP_001027603.1
Aliases /Synonyms Tropomyosin, tropomyosin-like protein
Reference PX-P1056
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Ciona intestinalis Tropomyosin Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products