Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

cDNA FLJ59602, highly similar to Lactotransferrin

Host species:
Mammalian cells
Uniprot ID:
B4E1L2
Molecular weight:
33.87kDa

210.00

50ug + 210 loyalty points
Gly20–IIe66
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

cDNA FLJ59602, highly similar to Lactotransferrin

Product name cDNA FLJ59602, highly similar to Lactotransferrin
Uniprot ID B4E1L2
Uniprot link https://www.uniprot.org/uniprot/B4E1L2
Expression system Eukaryotic expression
Raw Antigen Sequence MHSSALLCCLVLLTGVRAGRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIGGGGSGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 33.87kDa
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly20-IIe66
Aliases /Synonyms /
Reference PX-P4870
Note For research use only
Molecular Constructor
Gly20–IIe66
Product name cDNA FLJ59602, highly similar to Lactotransferrin
Uniprot ID B4E1L2
Uniprot link https://www.uniprot.org/uniprot/B4E1L2
Expression system Eukaryotic expression
Raw Antigen Sequence MHSSALLCCLVLLTGVRAGRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIGGGGSGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 33.87kDa
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly20-IIe66
Aliases /Synonyms /
Reference PX-P4870
Note For research use only
Molecular Constructor
Gly20–IIe66

There are no reviews yet.

Be the first to review “cDNA FLJ59602, highly similar to Lactotransferrin”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products