Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD95 Recombinant Protein |
|---|---|
| Uniprot ID | P25445 |
| Uniprot link | http://www.uniprot.org/uniprot/P25445 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN |
| Molecular weight | 30kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Asn173 |
| Aliases /Synonyms | APT1, FAS1, TNFRSF6 |
| Reference | PX-P4095 |
| Note | For research use only |
CD95 (APO-1 / Fas) is an important inducer of the extreme apoptosis signaling pathway. Therapeutic induction of apoptosis of many tumor cells has been linked to the activity of CD95. It is a typical death receptor, characterized by the presence of an 8 amino acid death domain in its cytoplasmic tail. This advantage is essential for the recruitment of a large number of signal components after activation of the agonist anti-CD95 antibody or bound CD95 ligand that initiates apoptosis. The protein complex formed after the release of CD95 is called the lethal induction signal complex. DISK is composed of adaptive proteins and priming caspins, which are essential to induce apoptosis. CD95 is also the key to negative selection of B cells in the reproductive center (GC). Impairment of CD95-mediated apoptosis leads to impaired affinity maturation and persistence of spontaneous B cell clones. Changes in the expression of CD95 and / or its CD95L ligand are often found in human cancers. CD95 down-regulation or mutation has been proposed to be a mechanism by which cancer cells prevent destruction of the immune system through reduced sensitivity to apoptosis. Therefore, CD95 is considered a tumor remover. CD95 is reported to be involved in the activation of NF-κB, MAPK3 / ERK1, MAPK8 / JNK, and alternative pathways of CTL-mediated cytotoxicity. Therefore, the protein is involved in the pathogenesis of various malignant tumors and diseases of the immune system. The CD95 / CD95L system is related to the etiology of inflammatory bowel disease (IBD), mainly because CD95 is found to be highly expressed in intestinal epithelial cells and increases epithelial cell apoptosis in IBD.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.