Cart (0 Items)
Your cart is currently empty.
View Products
              
              
              | size | 100ug  | 
		
|---|---|
| Brand | ProteoGenix  | 
		
| Product type | Recombinant Proteins  | 
		
| Host Species | Mammalian cells  | 
		
| Applications | Elisa, WB  | 
		
| Product name | CD66c Recombinant Protein | 
|---|---|
| Uniprot ID | P40199 | 
| Uniprot link | http://www.uniprot.org/uniprot/P40199 | 
| Origin species | Homo sapiens (Human) | 
| Expression system | Eukaryotic expression | 
| Sequence | MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG | 
| Molecular weight | 35-48kDa | 
| Protein delivered with Tag? | C-terminal His Tag | 
| Purity estimated | >90% by SDS-PAGE | 
| Buffer | PBS pH7.5 | 
| Delivery condition | Dry Ice | 
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. | 
| Brand | ProteoGenix | 
| Host species | Mammalian cells | 
| Fragment Type | Met1-Gly320 | 
| Aliases /Synonyms | CD66c,CEACAM6,NCA | 
| Reference | PX-P4088 | 
| Note | For research use only | 
The cell adhesion molecule associated with carcinoembryonic antigen 6 (non-specific cross-reactive antigen) (CEACAM6) is also known as CD66c (Cluster of Differentiation 66c), CEAL, NCA, and is one of the seven members of the human CEACAM family in the immunoglobulin superfamily. In humans, CEACAM includes type I transmembrane protein (CEACAM1, CEACAM3, and CEACAM4) and GPI-binding molecules (CEACAM5 to CEACAM8). There is no human CEACAM2. CEACAM 6 contains one N-terminal V-type Ig-like domain (N-domain), followed by two C2-like Ig-like domains. It shows considerable glycosylation, including LewisX (sialic acid), which mediates the binding of E-selectin, galectin, and certain bacterial fibers. CEACAM-6 is expressed by granulocytes and their precursors. It is also expressed in the epithelium of various organs and is regulated in adenocarcinomas of the pancreas and colon and hyperplastic polyps. In the case of overexpression of CEACAM6, it is resistant to adhesion-related apoptosis in tumor cells.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.