Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | CD63 Recombinant Protein |
---|---|
Uniprot ID | P08962 |
Uniprot link | http://www.uniprot.org/uniprot/P08962 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG |
Molecular weight | 15kDa |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Arg108~ Gly196 |
Aliases /Synonyms | MLA1, TSPAN30 |
Reference | PX-P4087 |
Note | For research use only |
The CD63 antigen is a protein encoded by the CD63 gene in humans. Although it can induce cell surface expression, CD63 is particularly associated with the membrane of intracellular vesicles. The protein encoded by this gene is a member of the transmembrane superfamily 4, also known as the family of the four transmembrane proteins. Most of these members are cell surface proteins, which are characterized by the presence of four hydrophobic domains. These proteins measure signal transduction events that play a role in regulating cell development, activation, growth and movement. This encoded protein is a cell surface glycoprotein complexed with integrins. It can be used as a sign of activation of blood cells. Lack of this protein is related to Hermansky-Pudlak syndrome. This gene is also related to tumor progression. It has been found to use alternating polyadenyl acid sites for this gene. Alternatively, splicing results in multiple transcriptional variants that encode different proteins.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.