Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD53 Recombinant Protein |
---|---|
Uniprot ID | P19397 |
Uniprot link | http://www.uniprot.org/uniprot/P19397 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | EQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSN |
Molecular weight | 50-75kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >95% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Glu107-Asn181 |
Aliases /Synonyms | MOX44, TSPAN25 |
Reference | PX-P4127 |
Note | For research use only |
CD53 is a member of the transmembrane superfamily 4, also known as the tetraspanin family. Most of these members are cell surface proteins, which are characterized by the presence of four hydrophobic domains. These proteins measure signal transduction events that play a role in regulating cell development, activation, growth and movement. CD53 is a cell surface glycoprotein known to be complex with integrins. Common defects in the CD53 gene are linked to immunodeficiency, which is related to recurrent infectious diseases caused by bacteria, fungi and viruses. CD53 contributes to the transduction of signals produced by CD2 in T cells and natural lethal cells and is thought to play a role in regulating growth.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.