Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD272 Recombinant Protein |
|---|---|
| Uniprot ID | Q7Z6A9 |
| Uniprot link | http://www.uniprot.org/uniprot/Q7Z6A9 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS |
| Molecular weight | 32kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Ser150 |
| Aliases /Synonyms | / |
| Reference | PX-P4114 |
| Note | For research use only |
CD272 (cluster of differentiation 272) is also designated as BTLA. BTLA expression is induced during T cell activation and BTLA is still expressed on Th1 cells instead of Th2 cells. Like PD1 and CTLA4, BTLA interacts with homologs B7 and B7H4. However, unlike PD-1 and CTLA-4, BTLA exhibits an inhibitory effect on T lymphocytes by interacting with familial neurotic tumor receptors (TNF-R), not just with cell surface receptors. Family interaction. BTLA is a linker of tumor necrosis factor 14 superfamily member (receptor) (TNFRSF14) and is also known as herpes virus mediator (HVEM). The BTLA-HVEM complex negatively regulates the immune response of T cells. Activation of BTLA inhibits the function of cancer-specific human CD8 + T cells.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.