Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD272 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q7Z6A9
Molecular weight:
32kDa

Original price was: €254.00.Current price is: €223.00.

50ug 12% OFF + 223 loyalty points
Met1~Ser150 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD272 Recombinant Protein

Product name PX-P4114-100
Uniprot ID Q7Z6A9
Uniprot link http://www.uniprot.org/uniprot/Q7Z6A9
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ser150
Aliases /Synonyms /
Reference PX-P4114
Note For research use only
Molecular Constructor
Met1~Ser150 His
Product name PX-P4114-1MG
Uniprot ID Q7Z6A9
Uniprot link http://www.uniprot.org/uniprot/Q7Z6A9
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ser150
Aliases /Synonyms /
Reference PX-P4114
Note For research use only
Molecular Constructor
Met1~Ser150 His
Product name PX-P4114-50
Uniprot ID Q7Z6A9
Uniprot link http://www.uniprot.org/uniprot/Q7Z6A9
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ser150
Aliases /Synonyms /
Reference PX-P4114
Note For research use only
Molecular Constructor
Met1~Ser150 His

General Information about CD272 Recombinant Protein

CD272 (cluster of differentiation 272) is also designated as BTLA. BTLA expression is induced during T cell activation and BTLA is still expressed on Th1 cells instead of Th2 cells. Like PD1 and CTLA4, BTLA interacts with homologs B7 and B7H4. However, unlike PD-1 and CTLA-4, BTLA exhibits an inhibitory effect on T lymphocytes by interacting with familial neurotic tumor receptors (TNF-R), not just with cell surface receptors. Family interaction. BTLA is a linker of tumor necrosis factor 14 superfamily member (receptor) (TNFRSF14) and is also known as herpes virus mediator (HVEM). The BTLA-HVEM complex negatively regulates the immune response of T cells. Activation of BTLA inhibits the function of cancer-specific human CD8 + T cells.

CD272 Recombinant Protein

There are no reviews yet.

Be the first to review “CD272 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products