Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD272 Recombinant Protein |
---|---|
Uniprot ID | Q7Z6A9 |
Uniprot link | http://www.uniprot.org/uniprot/Q7Z6A9 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS |
Molecular weight | 32kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1~Ser150 |
Aliases /Synonyms | / |
Reference | PX-P4114 |
Note | For research use only |
CD272 (cluster of differentiation 272) is also designated as BTLA. BTLA expression is induced during T cell activation and BTLA is still expressed on Th1 cells instead of Th2 cells. Like PD1 and CTLA4, BTLA interacts with homologs B7 and B7H4. However, unlike PD-1 and CTLA-4, BTLA exhibits an inhibitory effect on T lymphocytes by interacting with familial neurotic tumor receptors (TNF-R), not just with cell surface receptors. Family interaction. BTLA is a linker of tumor necrosis factor 14 superfamily member (receptor) (TNFRSF14) and is also known as herpes virus mediator (HVEM). The BTLA-HVEM complex negatively regulates the immune response of T cells. Activation of BTLA inhibits the function of cancer-specific human CD8 + T cells.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.