Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD254 / RANKL / TNFSF11, N-Fc, recombinant protein

  • PX-P5597
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O14788
Molecular weight:
48.32 kDa

420.00

100ug + 420 loyalty points
Fc Gly136–Asp317
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD254 / RANKL / TNFSF11, N-Fc, recombinant protein

Product name CD254 / RANKL / TNFSF11, N-Fc, recombinant protein
Uniprot ID O14788
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Molecular weight 48.32 kDa
Protein delivered with Tag? N-terminal Fc Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly136-Asp317
Protein Accession O14788
Reference PX-P5597
Note For research use only.
Molecular Constructor
Fc Gly136–Asp317

Denosumab Biosimilar – Anti-RANKL mAb – Research Grade binds to CD254 / RANKL / TNFSF11, N-Fc, recombinant protein in indirect ELISA Assay

Denosumab Biosimilar – Anti-RANKL mAb – Research Grade binds to CD254 / RANKL / TNFSF11, N-Fc, recombinant protein in indirect ELISA Assay

Immobilized CD254 / RANKL / TNFSF11, N-Fc, recombinant protein (cat. No.PX-P5597) at 5µg/mL (100µL/well) can bind to Denosumab Biosimilar- Anti-RANKL mAb- Research Grade (cat. No.PX-TA1018) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

CD254 / RANKL / TNFSF11, N-Fc, recombinant protein

There are no reviews yet.

Be the first to review “CD254 / RANKL / TNFSF11, N-Fc, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products