Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD226 Recombinant Protein |
|---|---|
| Uniprot ID | Q15762 |
| Uniprot link | http://www.uniprot.org/uniprot/Q15762 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN |
| Molecular weight | 40-50kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >95% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Asn247 |
| Aliases /Synonyms | DNAM1 |
| Reference | PX-P4126 |
| Note | For research use only |
The cluster of differentiation system (CD) is commonly used as a cell marker for immunophenotyping. Different types of cells in the immune system can be identified by surface CD molecules related to cellular immune function. More than 32 unique CD groups and subcategories have been identified. Some CD molecules act as important receptors or ligands for cells, starting a signal cascade and then altering the cell’s behavior. Some CD proteins are not involved in the cell signaling process, but have other functions, such as cell incorporation. CD226, also known as PTA1 or DNAM-1, is a member of the immunoglobulin superfamily, which contains two Ig-like domains from group V. A high rate of CD226 (differentiation cluster 226) has been found on the surface of natural lethal cells, platelets, monocytes and some T cells. CD226 has binding sites for CD112 and CD155 and mediates cell adhesion to other cells containing their ligands.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.