Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD126 Recombinant Protein |
|---|---|
| Uniprot ID | P08887 |
| Uniprot link | http://www.uniprot.org/uniprot/P08887 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP |
| Molecular weight | 65kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Pro365 |
| Aliases /Synonyms | / |
| Reference | PX-P4104 |
| Note | For research use only |
The interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor.
Interleukin 6 (IL6) is an effective pleiotropic cytokine that can regulate cell differentiation and differentiation and plays an important role in the immune response. The unregulated production of IL6 and this receptor is involved in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer.
In melanocytes, IL6R gene expression can be regulated by MITF. The IL6 receptor is a protein complex composed of the ILUN-6 receptor subunit (IL6R) and the signal transduction glycoprotein 130 of interleukin 6. IL6R is also known as the human gene encoding this subunit. It is possible to report alternative transcription variants that encode different isoforms. The IL6R subunit is also shared by many other cytokines.
Immobilized CD126 Recombinant Protein (cat. No.PX-P4104) at 0.5µg/mL (100µL/well) can bind to Sarilumab Biosimilar - Anti-IL-6R mAb (cat. No.PX-TA1028) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.