Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cat CD137/TNFRSF9/4-1BB Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Cat
Uniprot ID:
XP_044890973.1

Original price was: €271.00.Current price is: €228.00.

50ug 16% OFF + 228 loyalty points
Met29–Ser190 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Cat CD137/TNFRSF9/4-1BB Recombinant Protein, C-Fc

Cat CD137/TNFRSF9/4-1BB Recombinant Protein, C-Fc

Product name PX-P7030-100
Uniprot ID XP_044890973.1
Origin species Cat
Expression system Eukaryotic expression
Raw Antigen Sequence MQDSCSKCPAGTFCEKTKDHICIACPSNSFSSTSGQRACDICRQCEGVFRTKKMCSPTSNAECECISGFHCLGERCTMCEQDCKQGQELTKEGCKDCCFGTFNDQKHGTCRPWTNCSLDGKSVLANGTKERDVLCGPASSDFFPRTTSATIPAPARDPGPTS
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met29-Ser190
Aliases /Synonyms Tumor necrosis factor receptor superfamily member 9, 4-1BB ligand receptor, CDw137, T-cell antigen 4-1BB homolog, T-cell antigen ILA, CD137, TNFRSF9
Reference PX-P7030
Note For research use only.
Molecular Constructor
Met29–Ser190 Fc
Product name PX-P7030-1MG
Uniprot ID XP_044890973.1
Origin species Cat
Expression system Eukaryotic expression
Raw Antigen Sequence MQDSCSKCPAGTFCEKTKDHICIACPSNSFSSTSGQRACDICRQCEGVFRTKKMCSPTSNAECECISGFHCLGERCTMCEQDCKQGQELTKEGCKDCCFGTFNDQKHGTCRPWTNCSLDGKSVLANGTKERDVLCGPASSDFFPRTTSATIPAPARDPGPTS
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met29-Ser190
Aliases /Synonyms Tumor necrosis factor receptor superfamily member 9, 4-1BB ligand receptor, CDw137, T-cell antigen 4-1BB homolog, T-cell antigen ILA, CD137, TNFRSF9
Reference PX-P7030
Note For research use only.
Molecular Constructor
Met29–Ser190 Fc
Product name PX-P7030-50
Uniprot ID XP_044890973.1
Origin species Cat
Expression system Eukaryotic expression
Raw Antigen Sequence MQDSCSKCPAGTFCEKTKDHICIACPSNSFSSTSGQRACDICRQCEGVFRTKKMCSPTSNAECECISGFHCLGERCTMCEQDCKQGQELTKEGCKDCCFGTFNDQKHGTCRPWTNCSLDGKSVLANGTKERDVLCGPASSDFFPRTTSATIPAPARDPGPTS
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met29-Ser190
Aliases /Synonyms Tumor necrosis factor receptor superfamily member 9, 4-1BB ligand receptor, CDw137, T-cell antigen 4-1BB homolog, T-cell antigen ILA, CD137, TNFRSF9
Reference PX-P7030
Note For research use only.
Molecular Constructor
Met29–Ser190 Fc

SDS-PAGE for Cat CD137/TNFRSF9/4-1BB Recombinant Protein, C-Fc

SDS-PAGE for Cat CD137/TNFRSF9/4-1BB Recombinant Protein, C-Fc

Cat CD137/TNFRSF9/4-1BB Recombinant Protein, C-Fc, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Cat CD137/TNFRSF9/4-1BB Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products