Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Camalprin Biosimilar – Anti-AAT protein – Research Grade

Origin species:
Human
Uniprot ID:
P01009

Original price was: €172.00.Current price is: €140.00.

50ug 19% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Camalprin Biosimilar - Anti-AAT protein - Research Grade

Product name PX-TA2224-50
Uniprot ID P01009
Source CAS: 2853491-11-7
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-AAT, SPAAT, PI, Alpha-1 protease inhibitor, Alpha-1-antitrypsin, Alpha-1-antiproteinase, SERPINA1, Serpin A1
Reference PX-TA2224-100
Note For research use only. Not suitable for human use.
Isotype Human alpha-1-antitrypsin-variant
Product name Camalprin Biosimilar - Anti-AAT protein - Research Grade
Uniprot ID P01009
Source CAS: 2853491-11-7
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-AAT, SPAAT, PI, Alpha-1 protease inhibitor, Alpha-1-antitrypsin, Alpha-1-antiproteinase, SERPINA1, Serpin A1
Reference PX-TA2224-100
Note For research use only. Not suitable for human use.
Isotype Human alpha-1-antitrypsin-variant
Product name Camalprin Biosimilar - Anti-AAT protein - Research Grade
Uniprot ID P01009
Source CAS: 2853491-11-7
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-AAT, SPAAT, PI, Alpha-1 protease inhibitor, Alpha-1-antitrypsin, Alpha-1-antiproteinase, SERPINA1, Serpin A1
Reference PX-TA2224-100
Note For research use only. Not suitable for human use.
Isotype Human alpha-1-antitrypsin-variant

Introduction

Camalprin Biosimilar is a therapeutic protein that has been developed as an anti-alpha-1 antitrypsin (AAT) protein. This biosimilar is a highly specific and potent inhibitor of AAT, a protein that plays a crucial role in the development of various diseases. In this article, we will discuss the structure, activity, and applications of Camalprin Biosimilar in the field of therapeutic protein research.

Structure of Camalprin Biosimilar

Camalprin Biosimilar is a recombinant protein that is produced through advanced biotechnological processes. It is a genetically engineered version of the naturally occurring AAT protein, with a similar structure and function. The primary structure of Camalprin Biosimilar is composed of 394 amino acids, with a molecular weight of approximately 52 kDa. It has a unique three-dimensional structure that is essential for its therapeutic activity.

The structure of Camalprin Biosimilar is similar to that of AAT, with a reactive center loop that interacts with its target enzyme, neutrophil elastase. This loop is responsible for the inhibitory activity of Camalprin Biosimilar, as it binds to and blocks the active site of neutrophil elastase, preventing it from damaging lung tissue.

Activity of Camalprin Biosimilar

Camalprin Biosimilar has a potent inhibitory activity against neutrophil elastase, an enzyme that is involved in the breakdown of connective tissue in the lungs. This enzyme is normally regulated by AAT, but in individuals with AAT deficiency, the enzyme is not properly inhibited, leading to lung damage and the development of diseases such as emphysema and chronic bronchitis.

By binding to and inhibiting neutrophil elastase, Camalprin Biosimilar helps to protect the lungs from damage and slows down the progression of these diseases. It also has anti-inflammatory properties, which further contribute to its therapeutic activity.

Applications of Camalprin Biosimilar

Camalprin Biosimilar has a wide range of applications in the field of therapeutic protein research. Its primary use is in the treatment of AAT deficiency, a genetic disorder that affects the lungs and liver. Individuals with this deficiency have a higher risk of developing lung diseases, and Camalprin Biosimilar offers a targeted and effective treatment option for these patients.

In addition to its use in AAT deficiency, Camalprin Biosimilar has also shown potential in the treatment of other diseases that involve neutrophil elastase, such as cystic fibrosis and chronic obstructive pulmonary disease (COPD). It has also been studied for its potential in treating inflammatory conditions, such as rheumatoid arthritis and psoriasis.

Furthermore, Camalprin Biosimilar has been used in research studies to better understand the role of AAT and neutrophil elastase in various diseases. Its highly specific inhibitory activity makes it a valuable tool for studying these enzymes and their interactions with other proteins and pathways.

Conclusion

In summary, Camalprin Biosimilar is a therapeutic protein that has been developed as an anti-AAT protein. Its unique structure and potent inhibitory activity make it a promising treatment option for AAT deficiency and other diseases involving neutrophil elastase. Its use in research studies also highlights its potential in furthering our understanding of these enzymes and their role in various diseases. With ongoing research and development, Camalprin Biosimilar has the potential to make a significant impact in the field of therapeutic protein research.

There are no reviews yet.

Be the first to review “Camalprin Biosimilar – Anti-AAT protein – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products