Brand: ProteoGenix

BTK, N-His, recombinant protein

PX-P5524
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q06187
Molecular weight:: 20.78 kDa

€329.00

100ug + 329 loyalty points

His Arg28–Thr184

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

BTK, N-His, recombinant protein

Product name	BTK, N-His, recombinant protein
Uniprot ID	Q06187
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	RLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKT
Molecular weight	20.78 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90% as determined by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Arg28-Thr184
Protein Accession	Q06187
Reference	PX-P5524
Note	For research use only
Molecular Constructor	His Arg28–Thr184