Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bezetabart Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb – Research Grade

  • PX-TA2109-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €182.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Bezetabart Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade

Product name PX-TA2109-50
Uniprot ID P04233
Source CAS: 2763746-69-4
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2109
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Bezetabart Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade
Uniprot ID P04233
Source CAS: 2763746-69-4
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2109
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Bezetabart Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade
Uniprot ID P04233
Source CAS: 2763746-69-4
Origin species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2109
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Bezetabart Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb

Bezetabart Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb is a monoclonal antibody that targets the human leukocyte antigen-DR (HLA-DR) antigens-associated invariant chain (Ii) protein. This biosimilar is a research grade product that has been developed as a potential therapeutic option for various autoimmune and inflammatory diseases. In this article, we will discuss the structure, activity, and potential applications of Bezetabart Biosimilar in detail.

Structure of Bezetabart Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb

Bezetabart Biosimilar is a monoclonal antibody that has been designed to target the Ii protein on HLA-DR antigens. The antibody is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL and CL’) and one variable domain (VL). The variable domains of both the heavy and light chains are responsible for binding to the target Ii protein.

Activity of Bezetabart Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb

Bezetabart Biosimilar is a highly specific monoclonal antibody that binds to the Ii protein on HLA-DR antigens with high affinity. The Ii protein is an important chaperone protein that is involved in the processing and presentation of antigens to T-cells. By binding to the Ii protein, Bezetabart Biosimilar blocks the interaction between the Ii protein and the HLA-DR antigens, thereby preventing the presentation of antigens to T-cells. This mechanism of action makes Bezetabart Biosimilar a potential therapeutic option for diseases where the activation of T-cells plays a crucial role.

Applications of Bezetabart Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb

Bezetabart Biosimilar has shown promising results in preclinical studies for the treatment of various autoimmune and inflammatory diseases. Some of the potential applications of this biosimilar are discussed below:

1. Rheumatoid Arthritis (RA): RA is a chronic autoimmune disease characterized by inflammation of the joints. The activation of T-cells plays a key role in the pathogenesis of RA. Bezetabart Biosimilar, by blocking the interaction between the Ii protein and HLA-DR antigens, can potentially inhibit the activation of T-cells and reduce inflammation in RA.

2. Multiple Sclerosis (MS): MS is a neuroinflammatory disease that is caused by the activation of autoreactive T-cells. Bezetabart Biosimilar has shown promising results in preclinical studies for the treatment of MS by inhibiting the activation of T-cells and reducing inflammation in the central nervous system.

3. Inflammatory Bowel Disease (IBD): IBD is a group of chronic inflammatory disorders of the gastrointestinal tract. T-cell activation has been implicated in the pathogenesis of IBD. Bezetabart Biosimilar has shown potential as a therapeutic option for IBD by inhibiting T-cell activation and reducing inflammation in the gut.

4. Psoriasis: Psoriasis is a chronic inflammatory skin disease that is characterized by abnormal activation of T-cells. Bezetabart Biosimilar, by inhibiting T-cell activation, has the potential to reduce inflammation and improve symptoms in psoriasis patients.

Conclusion

Bezetabart Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb is a promising research grade product that has shown potential as a therapeutic option for various autoimmune and inflammatory diseases. Its highly specific mechanism of action, targeting the Ii protein on HLA-DR antigens, makes it a unique and promising candidate for the treatment of these diseases. Further clinical studies are needed to evaluate the safety and efficacy of Bezetabart Biosimilar in humans.

Research Grade Bezetabart in ELISA Assay

Research Grade Bezetabart in ELISA Assay

Research Grade Bezetabart can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Bezetabart

SDS-PAGE for Research Grade Bezetabart

Research Grade Bezetabart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Bezetabart Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade

There are no reviews yet.

Be the first to review “Bezetabart Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products