Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1035)

Note:
For research use only. Not suitable for human use.

380.00

100ug + 380 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1035)

Product name Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1035)
Uniprot ID Q9KMA6
Raw Antigen Sequence MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLTIYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Aliases /Synonyms anti-Toxin HigB-2, anti-higB-2, anti-VC_A0468
Reference ARO-A16230
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen higB-2
Clone Name SAA1035
Target species Anti-Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Monoclonal Antibody

SDS-PAGE for Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1035)

SDS-PAGE for Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1035)

Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1035), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1035)

There are no reviews yet.

Be the first to review “Anti-Vibrio cholerae serotype O1 higB-2 VHH (SAA1035)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products