Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Vaccinia virus/VACV A27L Antibody (203#)

  • ARO-A14955-100
  • Validated WB

Original price was: €401.00.Current price is: €331.00.

100ug 17% OFF + 331 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Vaccinia virus/VACV A27L Antibody (203#)
Anti-Vaccinia virus/VACV A27L Antibody (203#) in WB Assay
Anti-Vaccinia virus/VACV A27L Antibody (203#)

Anti-Vaccinia virus/VACV A27L Antibody (203#)

Product name ARO-A14955-100
Uniprot ID P11258
Raw Antigen Sequence MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strainWR))
Reference ARO-A14955
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Protein A27, VACWR150, A27L, Vaccinia virus (VACV)
Target species Anti-Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strainWR)) Monoclonal Antibody
Product name ARO-A14955-1MG
Uniprot ID P11258
Raw Antigen Sequence MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strainWR))
Reference ARO-A14955
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Protein A27, VACWR150, A27L, Vaccinia virus (VACV)
Target species Anti-Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strainWR)) Monoclonal Antibody
Product name ARO-A14955-50
Uniprot ID P11258
Raw Antigen Sequence MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strainWR))
Reference ARO-A14955
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Protein A27, VACWR150, A27L, Vaccinia virus (VACV)
Target species Anti-Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strainWR)) Monoclonal Antibody

SDS-PAGE for Anti-Vaccinia virus/VACV A27L Antibody (203#)

SDS-PAGE for Anti-Vaccinia virus/VACV A27L Antibody (203#)

Anti-Vaccinia virus/VACV A27L Antibody (203#), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Vaccinia virus/VACV A27L Antibody (203#) in WB Assay

Anti-Vaccinia virus/VACV A27L Antibody (203#) in WB Assay

Anti-Vaccinia virus/VACV A27L Antibody (203#) can bind to its target in Western Blot Assay as detected on gel analysis.

Anti-Vaccinia virus/VACV A27L Antibody (203#)

There are no reviews yet.

Be the first to review “Anti-Vaccinia virus/VACV A27L Antibody (203#)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products