Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Isotype | IgG2b |
| Applications | Elisa, WB |
| Host Species | Mouse |
| Clonality | Monoclonal Antibody |
| Target species | Anti-General Monoclonal Antibody |
| Brand | Arovia |
| Product name | Anti-Twin-Strep-tag(SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) Antibody (SAA0348) |
|---|---|
| Form | 0.01M PBS, pH 7.4. |
| Delivery condition | Blue ice (+4°C) |
| Storage condition | 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles |
| Brand | Arovia |
| Host species | Mouse |
| Reactivity | General |
| Reference | ARO-A14956 |
| Isotype | IgG2b |
| Clonality | Monoclonal Antibody |
| Purification | Protein A or G purified from cell culture supernatant. |
| Immunogen | Twin-Strep-tag, Twin Strep tag, TwinStrep tag,Streptag,Strep tag |
| Target species | Anti-General Monoclonal Antibody |
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.