Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-SREBF1/SREBP1 Polyclonal antibody

  • ARO-A13988-100
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: €216.00.Current price is: €169.00.

100ug 22% OFF + 169 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-SREBF1/SREBP1 Polyclonal antibody binds to Recombinant Human SREBF1/SREBP1 Protein, N-His in WB Assay
Anti-SREBF1/SREBP1 Polyclonal antibody

Anti-SREBF1/SREBP1 Polyclonal antibody

Product name ARO-A13988-100
Uniprot ID P36956
Raw Antigen Sequence EDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Sterol regulatory element-binding protein 1,SREBF1,BHLHD1,Transcription factor SREBF1,Sterol regulatory element-binding transcription factor 1,Class D basic helix-loop-helix protein 1,bHLHd1,SREBP-1,SREBP1,
Reference ARO-A13988
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human SREBF1 / SREBP1 (Glu30-Leu490).
Product name ARO-A13988-1MG
Uniprot ID P36956
Raw Antigen Sequence EDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Sterol regulatory element-binding protein 1,SREBF1,BHLHD1,Transcription factor SREBF1,Sterol regulatory element-binding transcription factor 1,Class D basic helix-loop-helix protein 1,bHLHd1,SREBP-1,SREBP1,
Reference ARO-A13988
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human SREBF1 / SREBP1 (Glu30-Leu490).
Product name ARO-A13988-50
Uniprot ID P36956
Raw Antigen Sequence EDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Sterol regulatory element-binding protein 1,SREBF1,BHLHD1,Transcription factor SREBF1,Sterol regulatory element-binding transcription factor 1,Class D basic helix-loop-helix protein 1,bHLHd1,SREBP-1,SREBP1,
Reference ARO-A13988
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human SREBF1 / SREBP1 (Glu30-Leu490).

The Anti-SREBF1/SREBP1 polyclonal antibody is designed for the detection of Sterol Regulatory Element-Binding Protein 1, a transcription factor involved in lipid metabolism and cellular regulation.

This antibody enables researchers to analyze protein expression and investigate metabolic pathways related to lipid biosynthesis and cellular homeostasis in various experimental models.

Biological Background

Sterol Regulatory Element-Binding Protein 1 is a key regulator of genes involved in:

  • lipid synthesis
  • fatty acid metabolism
  • cellular metabolic processes

It is widely studied in research areas such as:

  • metabolic regulation
  • lipid homeostasis
  • cellular signaling pathways

Applications

This antibody is suitable for research applications including:

Related Services

Anti-SREBF1/SREBP1 Polyclonal antibody binds to Recombinant Human SREBF1/SREBP1 Protein, N-His in WB Assay

Anti-SREBF1/SREBP1 Polyclonal antibody binds to Recombinant Human SREBF1/SREBP1 Protein, N-His in WB Assay

Recombinant Human SREBF1/SREBP1 Protein, N-His(cat. No.ARO-P14924) can bind Anti-SREBF1/SREBP1 Polyclonal antibody in Western Blot Assay as detected on gel analysis.

Anti-SREBF1/SREBP1 Polyclonal antibody

There are no reviews yet.

Be the first to review “Anti-SREBF1/SREBP1 Polyclonal antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products