Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-PHLPVII/Polcalcin Phl p 7 Antibody (SAA0749)

Original price was: €326.00.Current price is: €272.00.

50ug 17% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-PHLPVII/Polcalcin Phl p 7 Antibody (SAA0749)

Product name ARO-A14728-100
Uniprot ID O82040
Raw Antigen Sequence MADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A14728
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen P7, PHLPVII, Polcalcin Phl p 7, Calcium-binding pollen allergen Phl p 7, Phl p 7, Protein P7
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody
Product name ARO-A14728-1MG
Uniprot ID O82040
Raw Antigen Sequence MADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A14728
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen P7, PHLPVII, Polcalcin Phl p 7, Calcium-binding pollen allergen Phl p 7, Phl p 7, Protein P7
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody
Product name ARO-A14728-50
Uniprot ID O82040
Raw Antigen Sequence MADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A14728
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen P7, PHLPVII, Polcalcin Phl p 7, Calcium-binding pollen allergen Phl p 7, Phl p 7, Protein P7
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody

SDS-PAGE for Anti-PHLPVII/Polcalcin Phl p 7 Antibody (SAA0749)

SDS-PAGE for Anti-PHLPVII/Polcalcin Phl p 7 Antibody (SAA0749)

Anti-PHLPVII/Polcalcin Phl p 7 Antibody (SAA0749), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-PHLPVII/Polcalcin Phl p 7 Antibody (SAA0749)

There are no reviews yet.

Be the first to review “Anti-PHLPVII/Polcalcin Phl p 7 Antibody (SAA0749)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products