Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2)

  • ARO-A15068-50
  • Validated ELISA WB

Original price was: €345.00.Current price is: €274.00.

50ug 21% OFF + 274 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2)

Product name ARO-A15068-100
Uniprot ID P43214
Raw Antigen Sequence MSMASSSSSSLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A15068
Isotype IgE
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Pollen allergen Phl p 2, Allergen Phl p II, Phl p 2, PHLPII
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody
Product name ARO-A15068-1MG
Uniprot ID P43214
Raw Antigen Sequence MSMASSSSSSLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A15068
Isotype IgE
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Pollen allergen Phl p 2, Allergen Phl p II, Phl p 2, PHLPII
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody
Product name ARO-A15068-50
Uniprot ID P43214
Raw Antigen Sequence MSMASSSSSSLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A15068
Isotype IgE
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Pollen allergen Phl p 2, Allergen Phl p II, Phl p 2, PHLPII
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody

Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2) binds to Recombinant Phleum pratense PHLPII/Phl p 2 Protein, N-His in WB Assay

Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2) binds to Recombinant Phleum pratense PHLPII/Phl p 2 Protein, N-His in WB Assay

Recombinant Phleum pratense PHLPII/Phl p 2 Protein, N-His(cat. No.ARO-P15607) can bind Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2) in Western Blot Assay as detected on gel analysis.

SDS-PAGE for Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2)

SDS-PAGE for Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2)

Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2)

There are no reviews yet.

Be the first to review “Anti-Phleum pratense PHLPII/Phlp2 Antibody (HuMab2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products