Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-PCV2 Cap/Capsid protein Antibody (3A5)

  • ARO-A14624-50
  • Validated ELISA

Original price was: €348.00.Current price is: €272.00.

50ug 22% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-PCV2 Cap/Capsid protein Antibody (3A5)

Product name ARO-A14624-100
Uniprot ID O56129
Raw Antigen Sequence MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMYVQFREFNLKDPPLKP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Porcine circovirus 2 (PCV2)
Reference ARO-A14624
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Capsid protein, Cap, ORF2, Porcine Circovirus (PCV)
Target species Anti-Porcine circovirus 2 (PCV2) Monoclonal Antibody
Product name ARO-A14624-1MG
Uniprot ID O56129
Raw Antigen Sequence MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMYVQFREFNLKDPPLKP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Porcine circovirus 2 (PCV2)
Reference ARO-A14624
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Capsid protein, Cap, ORF2, Porcine Circovirus (PCV)
Target species Anti-Porcine circovirus 2 (PCV2) Monoclonal Antibody
Product name ARO-A14624-50
Uniprot ID O56129
Raw Antigen Sequence MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMYVQFREFNLKDPPLKP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Porcine circovirus 2 (PCV2)
Reference ARO-A14624
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Capsid protein, Cap, ORF2, Porcine Circovirus (PCV)
Target species Anti-Porcine circovirus 2 (PCV2) Monoclonal Antibody

SEC-HPLC of Anti-PCV2 Cap/Capsid protein Antibody (3A5)

SEC-HPLC of Anti-PCV2 Cap/Capsid protein Antibody (3A5)

Anti-PCV2 Cap/Capsid protein Antibody (3A5)was analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Anti-PCV2 Cap/Capsid protein Antibody (3A5)

SDS-PAGE for Anti-PCV2 Cap/Capsid protein Antibody (3A5)

Anti-PCV2 Cap/Capsid protein Antibody (3A5), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-PCV2 Cap/Capsid protein Antibody (3A5)

There are no reviews yet.

Be the first to review “Anti-PCV2 Cap/Capsid protein Antibody (3A5)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products