Anti-ORF8 protein polyclonal antibody
Size | 100ug |
---|---|
Brand | |
Product type | |
Host Species | |
Clonality | |
Applications |
Product name | Anti-ORF8 protein polyclonal antibody |
---|---|
Source | P0DTC8 |
Species | SARS-CoV-2 |
Molecular weight | 13kDa |
Buffer | PBS, pH7.4, containing 0.05% proclin300, 50% glycerol |
Form | Liquid |
Delivery condition | Blue ice (+4°) |
Storage condition | 4°C for short term; -20°c or -80°C for long term |
Brand | Proteogenix |
Host species | Rabbit |
Applications | ELISA |
Aliases – Synonyms | Non-structural protein 8 |
Size | 100ug |
Reference | PTXCOV-A560 |
Note | For research use and in vitro diagnostic only. Not suitable for human use. |
Isotype | IgG |
Clonality | Polyclonal Antibody |
Target | ORF8: MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.