Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-ORF8 protein polyclonal antibody

Note:
For research use and in vitro diagnostic only. Not suitable for human use.

169.00

100ug + 169 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-ORF8 protein polyclonal antibody

Anti-ORF8 protein polyclonal antibody

Product name Anti-ORF8 protein polyclonal antibody
Source P0DTC8
Species SARS-CoV-2
Molecular weight 13kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms Non-structural protein 8
Size 100ug
Reference PTXCOV-A560
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target ORF8: MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

There are no reviews yet.

Be the first to review “Anti-ORF8 protein polyclonal antibody”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products