Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-NPPA Polyclonal antibody

  • ARO-A13537-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: €159.00.Current price is: €118.00.

50ug 26% OFF + 118 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-NPPA Polyclonal antibody

Product name ARO-A13537-100
Uniprot ID P01160
Raw Antigen Sequence ANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Cardiodilatin,Pro atrial natriuretic factor 1-30,ANF 3-33,proANP,Atrial natriuretic factor prohormone,ANF 1-33,URO,LANH,proANP 31-67,Atrial natriuretic factor,Atrial natriuretic factor 8-33,VSDL,Atriopeptin I,CDD-ANF,ANF 8-33,Atrial natriuretic peptide prohormone,preproCDD-ANF,KP,CDD 95-126,Atrial natriuretic factor 3-33,Pro atrial natriuretic factor 99-126,Atrial natriuretic factor 1-33,proANP 95-126,proANF 99-126,proANF 79-98,Pro atrial natriuretic factor 31-67,ANP,Atriopeptin III,Alpha-hANP,Pro atrial natriuretic peptide 79-98,ANF,preproANP,Atriopeptin II,PND,Pro atrial natriuretic peptide 95-126,Natriuretic peptides A,Pro atrial natriuretic peptide 1-30,CDD-ANP (95-126),proANP 79-98,Pro atrial natriuretic factor 79-98,Atriopeptigen,proANF,CDD,proANF 1-30,LANP,CDD-ANP (99-126),Pro atrial natriuretic peptide 31-67,NPPA,Alpha-atrial natriuretic peptide,proANF 31-67,Cardionatrin,Long-acting natriuretic hormone,proANP 1-30,
Reference ARO-A13537
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human NPPA (Ala25-Arg123).
Product name ARO-A13537-1MG
Uniprot ID P01160
Raw Antigen Sequence ANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Cardiodilatin,Pro atrial natriuretic factor 1-30,ANF 3-33,proANP,Atrial natriuretic factor prohormone,ANF 1-33,URO,LANH,proANP 31-67,Atrial natriuretic factor,Atrial natriuretic factor 8-33,VSDL,Atriopeptin I,CDD-ANF,ANF 8-33,Atrial natriuretic peptide prohormone,preproCDD-ANF,KP,CDD 95-126,Atrial natriuretic factor 3-33,Pro atrial natriuretic factor 99-126,Atrial natriuretic factor 1-33,proANP 95-126,proANF 99-126,proANF 79-98,Pro atrial natriuretic factor 31-67,ANP,Atriopeptin III,Alpha-hANP,Pro atrial natriuretic peptide 79-98,ANF,preproANP,Atriopeptin II,PND,Pro atrial natriuretic peptide 95-126,Natriuretic peptides A,Pro atrial natriuretic peptide 1-30,CDD-ANP (95-126),proANP 79-98,Pro atrial natriuretic factor 79-98,Atriopeptigen,proANF,CDD,proANF 1-30,LANP,CDD-ANP (99-126),Pro atrial natriuretic peptide 31-67,NPPA,Alpha-atrial natriuretic peptide,proANF 31-67,Cardionatrin,Long-acting natriuretic hormone,proANP 1-30,
Reference ARO-A13537
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human NPPA (Ala25-Arg123).
Product name ARO-A13537-50
Uniprot ID P01160
Raw Antigen Sequence ANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Cardiodilatin,Pro atrial natriuretic factor 1-30,ANF 3-33,proANP,Atrial natriuretic factor prohormone,ANF 1-33,URO,LANH,proANP 31-67,Atrial natriuretic factor,Atrial natriuretic factor 8-33,VSDL,Atriopeptin I,CDD-ANF,ANF 8-33,Atrial natriuretic peptide prohormone,preproCDD-ANF,KP,CDD 95-126,Atrial natriuretic factor 3-33,Pro atrial natriuretic factor 99-126,Atrial natriuretic factor 1-33,proANP 95-126,proANF 99-126,proANF 79-98,Pro atrial natriuretic factor 31-67,ANP,Atriopeptin III,Alpha-hANP,Pro atrial natriuretic peptide 79-98,ANF,preproANP,Atriopeptin II,PND,Pro atrial natriuretic peptide 95-126,Natriuretic peptides A,Pro atrial natriuretic peptide 1-30,CDD-ANP (95-126),proANP 79-98,Pro atrial natriuretic factor 79-98,Atriopeptigen,proANF,CDD,proANF 1-30,LANP,CDD-ANP (99-126),Pro atrial natriuretic peptide 31-67,NPPA,Alpha-atrial natriuretic peptide,proANF 31-67,Cardionatrin,Long-acting natriuretic hormone,proANP 1-30,
Reference ARO-A13537
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human NPPA (Ala25-Arg123).

Anti-NPPA Polyclonal antibody binds to Recombinant Human NPPA, N-GST in WB Assay

Anti-NPPA Polyclonal antibody binds to Recombinant Human NPPA, N-GST in WB Assay

Recombinant Human NPPA, N-GST(cat. No.ARO-P14195) can bind Anti-NPPA Polyclonal antibody in Western Blot Assay as detected on gel analysis.

Anti-NPPA Polyclonal antibody

There are no reviews yet.

Be the first to review “Anti-NPPA Polyclonal antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products