Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597)

  • ARO-A15617-50
  • Validated ELISA

Original price was: €337.00.Current price is: €274.00.

50ug 19% OFF + 274 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597) in ELISA Assay
Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597)

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597)

Product name ARO-A15617-100
Uniprot ID P01852 & P01849
Raw Antigen Sequence EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15617
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TCR αβ/alpha-beta TCR
Clone Name H57-597
Protein Name TCR αβ/alpha-beta TCR
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15617-1MG
Uniprot ID P01852 & P01849
Raw Antigen Sequence EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15617
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TCR αβ/alpha-beta TCR
Clone Name H57-597
Protein Name TCR αβ/alpha-beta TCR
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15617-50
Uniprot ID P01852 & P01849
Raw Antigen Sequence EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAMVKRKNS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15617
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TCR αβ/alpha-beta TCR
Clone Name H57-597
Protein Name TCR αβ/alpha-beta TCR
Target species Anti-Mouse Monoclonal Antibody

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597) in ELISA Assay

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597) in ELISA Assay

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597) can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597)

There are no reviews yet.

Be the first to review “Anti-Mouse TCR αβ/alpha-beta TCR Antibody (H57-597)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products