Brand: ProteoGenix

Anti-Mouse MPST Polyclonal Antibody

PTX20787-50
Validated WB

Clonality:: Polyclonal Antibody
Host species:: Rabbit
Isotype:: IgG

Original price was: €165.00.Current price is: €118.00.

50ug 28% OFF + 118 loyalty points

Size Size

50ug Original price was: €165.00.Current price is: €118.00.
100ug Original price was: €233.00.Current price is: €169.00.
1MG Original price was: €662.00.Current price is: €490.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Mouse MPST Polyclonal Antibody

Product name	PTX20787-100
Uniprot ID	Q99J99
Raw Antigen Sequence	SAQWVAEALKAPRSSQPLKLLDASWYLPKLGRDARREFEERHIPGAAFFDIDRCSDHTSPYDHMLPNATHFADYAGSLGVSAATHVVIYDDSDQGLYSAPRVWWMFRAFGHHSVSLLDGGFRHWLNQNLPISSGKSHSEPAEFSAQLDPSFIKTHEDILENLDARRFQVVDARAAGRFQGTQPEPRDGIEPGHIPGSVNIPFTEFLTNEGLEKSPEEIKRLFKEKKVDLSKPLVATCGSGVTACHVVLGAFLCGKSDVPVYDGSWVEWYMRAQPEHIISEGR
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-MPST
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	MPST
Dilution	ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Product name	PTX20787-1MG
Uniprot ID	Q99J99
Raw Antigen Sequence	SAQWVAEALKAPRSSQPLKLLDASWYLPKLGRDARREFEERHIPGAAFFDIDRCSDHTSPYDHMLPNATHFADYAGSLGVSAATHVVIYDDSDQGLYSAPRVWWMFRAFGHHSVSLLDGGFRHWLNQNLPISSGKSHSEPAEFSAQLDPSFIKTHEDILENLDARRFQVVDARAAGRFQGTQPEPRDGIEPGHIPGSVNIPFTEFLTNEGLEKSPEEIKRLFKEKKVDLSKPLVATCGSGVTACHVVLGAFLCGKSDVPVYDGSWVEWYMRAQPEHIISEGR
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-MPST
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	MPST
Dilution	ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Product name	PTX20787-50
Uniprot ID	Q99J99
Raw Antigen Sequence	SAQWVAEALKAPRSSQPLKLLDASWYLPKLGRDARREFEERHIPGAAFFDIDRCSDHTSPYDHMLPNATHFADYAGSLGVSAATHVVIYDDSDQGLYSAPRVWWMFRAFGHHSVSLLDGGFRHWLNQNLPISSGKSHSEPAEFSAQLDPSFIKTHEDILENLDARRFQVVDARAAGRFQGTQPEPRDGIEPGHIPGSVNIPFTEFLTNEGLEKSPEEIKRLFKEKKVDLSKPLVATCGSGVTACHVVLGAFLCGKSDVPVYDGSWVEWYMRAQPEHIISEGR
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-MPST
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	MPST
Dilution	ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Datasheet

Anti-Mouse MPST Polyclonal Antibody binds to Recombinant Human MPST Protein, N-His in WB Assay

Recombinant Human MPST Protein, N-His(cat. No.ARO-P14853) can bind Anti-Mouse MPST Polyclonal Antibody in Western Blot Assay as detected on gel analysis.