Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse CD8a/Lyt2 Antibody (53-6.72), PE

Clonality:
Monoclonal Antibody
Host species:
Rat
Isotype:
IgG2a, kappa
Target species:
Mouse
Clone Name:
53-6.72

Original price was: €265.00.Current price is: €189.00.

100ug 29% OFF + 189 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse CD8a/Lyt2 Antibody (53-6.72), PE

Product name ARO-A10671-100
Uniprot ID P01731
Raw Antigen Sequence MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rat
Aliases /Synonyms Anti-T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A,CD8
Reference ARO-A10671
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A,CD8
Clone Name 53-6.72
Target species Mouse
Product name ARO-A10671-1MG
Uniprot ID P01731
Raw Antigen Sequence MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rat
Aliases /Synonyms Anti-T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A,CD8
Reference ARO-A10671
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A,CD8
Clone Name 53-6.72
Target species Mouse
Product name ARO-A10671-50
Uniprot ID P01731
Raw Antigen Sequence MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rat
Aliases /Synonyms Anti-T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A,CD8
Reference ARO-A10671
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A,CD8
Clone Name 53-6.72
Target species Mouse

There are no reviews yet.

Be the first to review “Anti-Mouse CD8a/Lyt2 Antibody (53-6.72), PE”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products