Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Mouse CD370/CLEC9A Antibody (SAA0484)

Original price was: €473.00.Current price is: €388.00.

100ug 18% OFF + 388 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Mouse CD370/CLEC9A Antibody (SAA0484)
Anti-Mouse CD370/CLEC9A Antibody (SAA0484)

Anti-Mouse CD370/CLEC9A Antibody (SAA0484)

Product name ARO-A15602-100
Uniprot ID Q8BRU4
Raw Antigen Sequence MHAEEIYTSLQWDIPTSEASQKCQSPSKCSGAWCVVTMISCVVCMGLLATSIFLGIKFFQVSSLVLEQQERLIQQDTALVNLTQWQRKYTLEYCQALLQRSLHSGSDCSPCPHNWIQNGKSCYYVFERWEMWNISKKSCLKEGASLFQIDSKEEMEFISSIGKLKGGNKYWVGVFQDGISGSWFWEDGSSPLSDLLPAERQRSAGQICGYLKDSTLISDKCDSWKYFICEKKAFGSCI
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse
Reference ARO-A15602
Isotype VHH-mFc
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD370/CLEC9A
Clone Name SAA0484
Protein Name CD370/CLEC9A
Target species Anti-Human, Mouse Monoclonal Antibody
Product name ARO-A15602-1MG
Uniprot ID Q8BRU4
Raw Antigen Sequence MHAEEIYTSLQWDIPTSEASQKCQSPSKCSGAWCVVTMISCVVCMGLLATSIFLGIKFFQVSSLVLEQQERLIQQDTALVNLTQWQRKYTLEYCQALLQRSLHSGSDCSPCPHNWIQNGKSCYYVFERWEMWNISKKSCLKEGASLFQIDSKEEMEFISSIGKLKGGNKYWVGVFQDGISGSWFWEDGSSPLSDLLPAERQRSAGQICGYLKDSTLISDKCDSWKYFICEKKAFGSCI
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse
Reference ARO-A15602
Isotype VHH-mFc
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD370/CLEC9A
Clone Name SAA0484
Protein Name CD370/CLEC9A
Target species Anti-Human, Mouse Monoclonal Antibody
Product name ARO-A15602-50
Uniprot ID Q8BRU4
Raw Antigen Sequence MHAEEIYTSLQWDIPTSEASQKCQSPSKCSGAWCVVTMISCVVCMGLLATSIFLGIKFFQVSSLVLEQQERLIQQDTALVNLTQWQRKYTLEYCQALLQRSLHSGSDCSPCPHNWIQNGKSCYYVFERWEMWNISKKSCLKEGASLFQIDSKEEMEFISSIGKLKGGNKYWVGVFQDGISGSWFWEDGSSPLSDLLPAERQRSAGQICGYLKDSTLISDKCDSWKYFICEKKAFGSCI
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse
Reference ARO-A15602
Isotype VHH-mFc
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD370/CLEC9A
Clone Name SAA0484
Protein Name CD370/CLEC9A
Target species Anti-Human, Mouse Monoclonal Antibody

SDS-PAGE for Anti-Mouse CD370/CLEC9A Antibody (SAA0484)

SDS-PAGE for Anti-Mouse CD370/CLEC9A Antibody (SAA0484)

Anti-Mouse CD370/CLEC9A Antibody (SAA0484), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Mouse CD370/CLEC9A Antibody (SAA0484)

There are no reviews yet.

Be the first to review “Anti-Mouse CD370/CLEC9A Antibody (SAA0484)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products