Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse CD357/TNFRSF18/GITR Antibody (DTA-1)

Original price was: €253.00.Current price is: €198.00.

50ug 22% OFF + 198 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse CD357/TNFRSF18/GITR Antibody (DTA-1)

Product name ARO-A15648-100
Uniprot ID O35714
Raw Antigen Sequence MGAWAMLYGVSMLCVLDLGQPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAACIFFLTTVQLGLHIWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15648
Isotype IgG2b, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD357/TNFRSF18/GITR
Clone Name DTA-1
Protein Name CD357/TNFRSF18/GITR
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15648-1MG
Uniprot ID O35714
Raw Antigen Sequence MGAWAMLYGVSMLCVLDLGQPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAACIFFLTTVQLGLHIWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15648
Isotype IgG2b, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD357/TNFRSF18/GITR
Clone Name DTA-1
Protein Name CD357/TNFRSF18/GITR
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15648-50
Uniprot ID O35714
Raw Antigen Sequence MGAWAMLYGVSMLCVLDLGQPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAACIFFLTTVQLGLHIWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15648
Isotype IgG2b, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD357/TNFRSF18/GITR
Clone Name DTA-1
Protein Name CD357/TNFRSF18/GITR
Target species Anti-Mouse Monoclonal Antibody

Anti-Mouse CD357/TNFRSF18/GITR Antibody (DTA-1)

There are no reviews yet.

Be the first to review “Anti-Mouse CD357/TNFRSF18/GITR Antibody (DTA-1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products