Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse CD137/4-1BB/TNFRSF9 Antibody (3H3)

  • ARO-A15698-50
  • Validated FC

Original price was: €364.00.Current price is: €272.00.

50ug 25% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse CD137/4-1BB/TNFRSF9 Antibody (3H3)

Product name ARO-A15698-100
Uniprot ID P20334
Raw Antigen Sequence MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15698
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD137/4-1BB/TNFRSF9
Clone Name 3H3
Protein Name CD137/4-1BB/TNFRSF9
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15698-1MG
Uniprot ID P20334
Raw Antigen Sequence MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15698
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD137/4-1BB/TNFRSF9
Clone Name 3H3
Protein Name CD137/4-1BB/TNFRSF9
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15698-50
Uniprot ID P20334
Raw Antigen Sequence MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15698
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD137/4-1BB/TNFRSF9
Clone Name 3H3
Protein Name CD137/4-1BB/TNFRSF9
Target species Anti-Mouse Monoclonal Antibody

Flow Cytometry results for Anti-Mouse CD137/4-1BB/TNFRSF9 Antibody (3H3)

Flow Cytometry results for Anti-Mouse CD137/4-1BB/TNFRSF9 Antibody (3H3)

Target Cells were stained with an irrelevant antibody or Anti-Mouse CD137/4-1BB/TNFRSF9 Antibody (3H3) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Mouse CD137/4-1BB/TNFRSF9 Antibody (3H3)

There are no reviews yet.

Be the first to review “Anti-Mouse CD137/4-1BB/TNFRSF9 Antibody (3H3)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products