Brand: ProteoGenix

Anti-LOXL4 Polyclonal antibody

ARO-A13683-50
Validated WB

Clonality:: Polyclonal Antibody
Host species:: Rabbit
Isotype:: IgG

Original price was: €143.00.Current price is: €118.00.

50ug 17% OFF + 118 loyalty points

Size Size

50ug Original price was: €143.00.Current price is: €118.00.
100ug Original price was: €215.00.Current price is: €169.00.
1MG Original price was: €681.00.Current price is: €490.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-LOXL4 Polyclonal antibody

Product name	ARO-A13683-100
Uniprot ID	Q96JB6
Raw Antigen Sequence	GCQHENDAAVRCNVPNMGFQNQVRLAGGRIPEEGLLEVQVEVNGVPRWGSVCSENWGLTEAMVACRQLGLGFAIHAYKETWFWSGTPRAQEVVMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQLVQETAYLEDRP
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-LOXC,Lysyl oxidase-related protein C,Lysyl oxidase-like protein 4,Lysyl oxidase homolog 4,LOXL4,
Reference	ARO-A13683
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant Human LOXL4 (Gly399-Pro552).

Product name	ARO-A13683-1MG
Uniprot ID	Q96JB6
Raw Antigen Sequence	GCQHENDAAVRCNVPNMGFQNQVRLAGGRIPEEGLLEVQVEVNGVPRWGSVCSENWGLTEAMVACRQLGLGFAIHAYKETWFWSGTPRAQEVVMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQLVQETAYLEDRP
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-LOXC,Lysyl oxidase-related protein C,Lysyl oxidase-like protein 4,Lysyl oxidase homolog 4,LOXL4,
Reference	ARO-A13683
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant Human LOXL4 (Gly399-Pro552).

Product name	ARO-A13683-50
Uniprot ID	Q96JB6
Raw Antigen Sequence	GCQHENDAAVRCNVPNMGFQNQVRLAGGRIPEEGLLEVQVEVNGVPRWGSVCSENWGLTEAMVACRQLGLGFAIHAYKETWFWSGTPRAQEVVMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQLVQETAYLEDRP
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-LOXC,Lysyl oxidase-related protein C,Lysyl oxidase-like protein 4,Lysyl oxidase homolog 4,LOXL4,
Reference	ARO-A13683
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant Human LOXL4 (Gly399-Pro552).