Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-LolPII/Allergen Lol p2 Antibody (SAA0671)

Original price was: €329.00.Current price is: €272.00.

50ug 17% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-LolPII/Allergen Lol p2 Antibody (SAA0671)

Product name ARO-A14793-100
Uniprot ID P14947
Raw Antigen Sequence AAPVEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYKPE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Lolium perenne (Perennial ryegrass)
Reference ARO-A14793
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Rye-grass pollen allergen Lol p2
Target species Anti-Lolium perenne (Perennial ryegrass) Monoclonal Antibody
Product name ARO-A14793-1MG
Uniprot ID P14947
Raw Antigen Sequence AAPVEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYKPE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Lolium perenne (Perennial ryegrass)
Reference ARO-A14793
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Rye-grass pollen allergen Lol p2
Target species Anti-Lolium perenne (Perennial ryegrass) Monoclonal Antibody
Product name ARO-A14793-50
Uniprot ID P14947
Raw Antigen Sequence AAPVEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYKPE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Lolium perenne (Perennial ryegrass)
Reference ARO-A14793
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Rye-grass pollen allergen Lol p2
Target species Anti-Lolium perenne (Perennial ryegrass) Monoclonal Antibody

SDS-PAGE for Anti-LolPII/Allergen Lol p2 Antibody (SAA0671)

SDS-PAGE for Anti-LolPII/Allergen Lol p2 Antibody (SAA0671)

Anti-LolPII/Allergen Lol p2 Antibody (SAA0671), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-LolPII/Allergen Lol p2 Antibody (SAA0671)

There are no reviews yet.

Be the first to review “Anti-LolPII/Allergen Lol p2 Antibody (SAA0671)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products