Brand: ProteoGenix

Anti-Human TREM2 VHH (SAA1136)

ARO-A16328-50
Validated ELISA

Note:: For research use only. Not suitable for human use.

Original price was: €359.00.Current price is: €266.00.

50ug 26% OFF + 266 loyalty points

Size Size

50ug Original price was: €359.00.Current price is: €266.00.
100ug Original price was: €471.00.Current price is: €380.00.
1MG Original price was: €1,488.00.Current price is: €1,102.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human TREM2 VHH (SAA1136)

Product name	ARO-A16328-100
Uniprot ID	Q9NZC2
Raw Antigen Sequence	MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Aliases /Synonyms	anti-Triggering receptor expressed on myeloid cells 2, anti-Triggering receptor expressed on monocytes 2, anti-TREM-2, anti-TREM2
Reference	ARO-A16328
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	TREM2
Clone Name	SAA1136
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A16328-1MG
Uniprot ID	Q9NZC2
Raw Antigen Sequence	MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Aliases /Synonyms	anti-Triggering receptor expressed on myeloid cells 2, anti-Triggering receptor expressed on monocytes 2, anti-TREM-2, anti-TREM2
Reference	ARO-A16328
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	TREM2
Clone Name	SAA1136
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A16328-50
Uniprot ID	Q9NZC2
Raw Antigen Sequence	MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Aliases /Synonyms	anti-Triggering receptor expressed on myeloid cells 2, anti-Triggering receptor expressed on monocytes 2, anti-TREM-2, anti-TREM2
Reference	ARO-A16328
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	TREM2
Clone Name	SAA1136
Target species	Anti-Human Monoclonal Antibody