Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human TNFSF12/APO3L Antibody (SAA0806)

  • ARO-A15414-50
  • Validated ELISA

Original price was: €348.00.Current price is: €272.00.

50ug 22% OFF + 272 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human TNFSF12/APO3L Antibody (SAA0806) binds to Human TNFSF12 recombinant protein in ELISA Assay
Anti-Human TNFSF12/APO3L Antibody (SAA0806)

Anti-Human TNFSF12/APO3L Antibody (SAA0806)

Product name ARO-A15414-100
Uniprot ID O43508
Raw Antigen Sequence MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15414
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TNFSF12/APO3L
Clone Name SAA0806
Protein Name TNFSF12/APO3L
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15414-1MG
Uniprot ID O43508
Raw Antigen Sequence MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15414
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TNFSF12/APO3L
Clone Name SAA0806
Protein Name TNFSF12/APO3L
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15414-50
Uniprot ID O43508
Raw Antigen Sequence MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15414
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TNFSF12/APO3L
Clone Name SAA0806
Protein Name TNFSF12/APO3L
Target species Anti-Human Monoclonal Antibody

Anti-Human TNFSF12/APO3L Antibody (SAA0806) binds to Human TNFSF12 recombinant protein in ELISA Assay

Anti-Human TNFSF12/APO3L Antibody (SAA0806) binds to Human TNFSF12 recombinant protein in ELISA Assay

Human TNFSF12 recombinant protein(cat. No.PX-P6489) at 0.5µg/mL (100µL/well) can bind Anti-Human TNFSF12/APO3L Antibody (SAA0806) in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Human TNFSF12/APO3L Antibody (SAA0806)

There are no reviews yet.

Be the first to review “Anti-Human TNFSF12/APO3L Antibody (SAA0806)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products