Brand: ProteoGenix

Anti-Human papillomavirus type 16 E6/Protein E6 VHH (SAA1338)

ARO-A16273-50
Quality Chart

Note:: For research use only. Not suitable for human use.

Original price was: €333.00.Current price is: €266.00.

50ug 20% OFF + 266 loyalty points

Size Size

50ug Original price was: €333.00.Current price is: €266.00.
100ug Original price was: €479.00.Current price is: €380.00.
1MG Original price was: €1,532.00.Current price is: €1,102.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human papillomavirus type 16 E6/Protein E6 VHH (SAA1338)

Product name	ARO-A16273-100
Uniprot ID	P03126
Raw Antigen Sequence	MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	XtenCHO
Reactivity	Human papillomavirus type 16
Aliases /Synonyms	anti-Protein E6, anti-E6, anti-Human papillomavirus type 16
Reference	ARO-A16273
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	E6/Protein E6
Clone Name	SAA1338
Target species	Anti-Human papillomavirus type 16 Monoclonal Antibody

Product name	ARO-A16273-1MG
Uniprot ID	P03126
Raw Antigen Sequence	MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	XtenCHO
Reactivity	Human papillomavirus type 16
Aliases /Synonyms	anti-Protein E6, anti-E6, anti-Human papillomavirus type 16
Reference	ARO-A16273
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	E6/Protein E6
Clone Name	SAA1338
Target species	Anti-Human papillomavirus type 16 Monoclonal Antibody

Product name	ARO-A16273-50
Uniprot ID	P03126
Raw Antigen Sequence	MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	XtenCHO
Reactivity	Human papillomavirus type 16
Aliases /Synonyms	anti-Protein E6, anti-E6, anti-Human papillomavirus type 16
Reference	ARO-A16273
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	E6/Protein E6
Clone Name	SAA1338
Target species	Anti-Human papillomavirus type 16 Monoclonal Antibody