Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human OSM/Oncostatin-M (GSK315234)

  • PTX26144-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €342.00.Current price is: €265.00.

50ug 23% OFF + 265 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human OSM/Oncostatin-M (GSK315234)

Product name PTX26144-100
Uniprot ID P13725
Raw Antigen Sequence MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-OSM, Anti-Oncostatin-M, GSK315234
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name OSM
Product name PTX26144-1MG
Uniprot ID P13725
Raw Antigen Sequence MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-OSM, Anti-Oncostatin-M, GSK315234
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name OSM
Product name PTX26144-50
Uniprot ID P13725
Raw Antigen Sequence MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-OSM, Anti-Oncostatin-M, GSK315234
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name OSM

Flow Cytometry results for Anti-Human OSM/Oncostatin-M (GSK315234)

Flow Cytometry results for Anti-Human OSM/Oncostatin-M (GSK315234)

Target Cells were stained with an irrelevant antibody or Anti-Human OSM/Oncostatin-M (GSK315234) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human OSM/Oncostatin-M (GSK315234) binds to Recombinant Human OSM/Oncostatin-M Protein, N-His in WB Assay

Anti-Human OSM/Oncostatin-M (GSK315234) binds to Recombinant Human OSM/Oncostatin-M Protein, N-His in WB Assay

Recombinant Human OSM/Oncostatin-M Protein, N-His(cat. No.ARO-P14734) can bind Anti-Human OSM/Oncostatin-M (GSK315234) in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-Human OSM/Oncostatin-M (GSK315234)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products