Brand: ProteoGenix

Anti-Human NOX1 Polyclonal Antibody

PTX20738-50
Validated WB

Clonality:: Polyclonal Antibody
Host species:: Rabbit
Isotype:: IgG

Original price was: €162.00.Current price is: €118.00.

50ug 27% OFF + 118 loyalty points

Size Size

50ug Original price was: €162.00.Current price is: €118.00.
100ug Original price was: €237.00.Current price is: €169.00.
1MG Original price was: €662.00.Current price is: €490.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human NOX1 Polyclonal Antibody

Product name	PTX20738-100
Uniprot ID	Q9Y5S8
Raw Antigen Sequence	WYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-NOX1
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	NOX1
Dilution	ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Product name	PTX20738-1MG
Uniprot ID	Q9Y5S8
Raw Antigen Sequence	WYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-NOX1
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	NOX1
Dilution	ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Product name	PTX20738-50
Uniprot ID	Q9Y5S8
Raw Antigen Sequence	WYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-NOX1
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	NOX1
Dilution	ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000