Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

  • ARO-A15407-50
  • Validated ELISA

Original price was: €359.00.Current price is: €272.00.

50ug 24% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

Product name ARO-A15407-100
Uniprot ID Q63345
Raw Antigen Sequence MAGVWSLSLPSCLLSLLLLLQLSRSYAGQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPFYWINPGVLALIALVPMLLLQVSVGLVFLFLQHRLRGKLRAEVENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse, Rat, Bovine
Reference ARO-A15407
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen MOG
Clone Name 8-18C5
Protein Name MOG
Target species Anti-Human, Mouse, Rat, Bovine Monoclonal Antibody
Product name ARO-A15407-1MG
Uniprot ID Q63345
Raw Antigen Sequence MAGVWSLSLPSCLLSLLLLLQLSRSYAGQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPFYWINPGVLALIALVPMLLLQVSVGLVFLFLQHRLRGKLRAEVENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse, Rat, Bovine
Reference ARO-A15407
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen MOG
Clone Name 8-18C5
Protein Name MOG
Target species Anti-Human, Mouse, Rat, Bovine Monoclonal Antibody
Product name ARO-A15407-50
Uniprot ID Q63345
Raw Antigen Sequence MAGVWSLSLPSCLLSLLLLLQLSRSYAGQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPFYWINPGVLALIALVPMLLLQVSVGLVFLFLQHRLRGKLRAEVENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human, Mouse, Rat, Bovine
Reference ARO-A15407
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen MOG
Clone Name 8-18C5
Protein Name MOG
Target species Anti-Human, Mouse, Rat, Bovine Monoclonal Antibody

SEC-HPLC of Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

SEC-HPLC of Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

Anti-Human/Mouse/Rat MOG Antibody (8-18C5)was analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

SDS-PAGE for Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

Anti-Human/Mouse/Rat MOG Antibody (8-18C5), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

There are no reviews yet.

Be the first to review “Anti-Human/Mouse/Rat MOG Antibody (8-18C5)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products