Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand:

Anti-Human MMP13 Monoclonal Antibody (40E09#)

  • PTX25216-50
  • Validated ELISA FC

Original price was: €360.00.Current price is: €265.00.

50ug 26% OFF + 265 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Human MMP13 Monoclonal Antibody (40E09#)
Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)
Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)
Anti-Human MMP13 Monoclonal Antibody (40E09#) binds to Recombinant Human MMP13, N-His in ELISA Assay

Anti-Human MMP13 Monoclonal Antibody (40E09#)

Product name PTX25216-100
Uniprot ID P45452
Raw Antigen Sequence MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mouse
Clonality Polyclonal Antibody
Product name PTX25216-1MG
Uniprot ID P45452
Raw Antigen Sequence MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mouse
Clonality Polyclonal Antibody
Product name PTX25216-50
Uniprot ID P45452
Raw Antigen Sequence MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mouse
Clonality Polyclonal Antibody

SDS-PAGE for Anti-Human MMP13 Monoclonal Antibody (40E09#)

SDS-PAGE for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Anti-Human MMP13 Monoclonal Antibody (40E09#), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow-cytometry using anti-human MMP13 antibody.MDA-MB-231 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human MMP13 antibody monoclonal antibody (Catalog # PTX25216 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow Cytometry results for Anti-Human MMP13 Monoclonal Antibody (40E09#)

Flow-cytometry using anti-human MMP13 antibody.HeLa cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human MMP13 antibody monoclonal antibody (Catalog # PTX25216 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human MMP13 Monoclonal Antibody (40E09#) binds to Recombinant Human MMP13, N-His in ELISA Assay

Anti-Human MMP13 Monoclonal Antibody (40E09#) binds to Recombinant Human MMP13, N-His in ELISA Assay

Recombinant Human MMP13, N-His(cat. No.ARO-P13754) at 0.5µg/mL (100µL/well) can bind Anti-Human MMP13 Monoclonal Antibody (40E09#) in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Anti-Human MMP13 Monoclonal Antibody (40E09#)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products