Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human LY6E/SCA-2 (RG 7841)

  • PTX26107-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG

Original price was: €366.00.Current price is: €265.00.

50ug 28% OFF + 265 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human LY6E/SCA-2 (RG 7841) binds to Mouse LY6E recombinant protein in ELISA Assay
SDS-PAGE for Anti-Human LY6E/SCA-2 (RG 7841)

Anti-Human LY6E/SCA-2 (RG 7841)

Product name PTX26107-100
Uniprot ID Q16553
Raw Antigen Sequence MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-LY6E, Anti-SCA-2, RG-7841, RG 7841, RG7841
Isotype IgG
Clonality Monoclonal Antibody
Protein Name LY6E
Product name PTX26107-1MG
Uniprot ID Q16553
Raw Antigen Sequence MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-LY6E, Anti-SCA-2, RG-7841, RG 7841, RG7841
Isotype IgG
Clonality Monoclonal Antibody
Protein Name LY6E
Product name PTX26107-50
Uniprot ID Q16553
Raw Antigen Sequence MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-LY6E, Anti-SCA-2, RG-7841, RG 7841, RG7841
Isotype IgG
Clonality Monoclonal Antibody
Protein Name LY6E

Anti-Human LY6E/SCA-2 (RG 7841) binds to Mouse LY6E recombinant protein in ELISA Assay

Anti-Human LY6E/SCA-2 (RG 7841) binds to Mouse LY6E recombinant protein in ELISA Assay

Mouse LY6E recombinant protein(cat. No.PX-P6501) at 0.5µg/mL (100µL/well) can bind Anti-Human LY6E/SCA-2 (RG 7841) in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Anti-Human LY6E/SCA-2 (RG 7841)

SDS-PAGE for Anti-Human LY6E/SCA-2 (RG 7841)

Anti-Human LY6E/SCA-2 (RG 7841), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Human LY6E/SCA-2 (RG 7841)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products