Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human KLK5 Antibody (SAA0868)

  • ARO-A14658-50
  • Validated ELISA WB

Original price was: €367.00.Current price is: €272.00.

50ug 26% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human KLK5 Antibody (SAA0868)

Product name ARO-A14658-100
Uniprot ID Q9Y337
Raw Antigen Sequence MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14658
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen KLK5, Stratum corneum tryptic enzyme, SCTE, Kallikrein-like protein 2, Kallikrein-5, KLK-L2
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14658-1MG
Uniprot ID Q9Y337
Raw Antigen Sequence MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14658
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen KLK5, Stratum corneum tryptic enzyme, SCTE, Kallikrein-like protein 2, Kallikrein-5, KLK-L2
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14658-50
Uniprot ID Q9Y337
Raw Antigen Sequence MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14658
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen KLK5, Stratum corneum tryptic enzyme, SCTE, Kallikrein-like protein 2, Kallikrein-5, KLK-L2
Target species Anti-Human Monoclonal Antibody

Anti-Human KLK5 Antibody (SAA0868) binds to Recombinant Mouse KLK5 Protein, N-His in WB Assay

Anti-Human KLK5 Antibody (SAA0868) binds to Recombinant Mouse KLK5 Protein, N-His in WB Assay

Recombinant Mouse KLK5 Protein, N-His(cat. No.ARO-P10473) can bind Anti-Human KLK5 Antibody (SAA0868) in Western Blot Assay as detected on gel analysis.

Anti-Human KLK5 Antibody (SAA0868) binds to Recombinant Mouse KLK5 Protein, N-His in ELISA Assay

Anti-Human KLK5 Antibody (SAA0868) binds to Recombinant Mouse KLK5 Protein, N-His in ELISA Assay

Recombinant Mouse KLK5 Protein, N-His(cat. No.ARO-P10473) at 0.5µg/mL (100µL/well) can bind Anti-Human KLK5 Antibody (SAA0868) in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Human KLK5 Antibody (SAA0868)

There are no reviews yet.

Be the first to review “Anti-Human KLK5 Antibody (SAA0868)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products