Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human FGF19 Antibody (SAA1435)

  • ARO-A15374-50
  • Validated ELISA FC WB

Original price was: €325.00.Current price is: €239.00.

50ug 26% OFF + 239 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human FGF19 Antibody (SAA1435) binds to Recombinant Human FGF19, N-His in WB Assay
Flow Cytometry results for Anti-Human FGF19 Antibody (SAA1435)
Anti-Human FGF19 Antibody (SAA1435)

Anti-Human FGF19 Antibody (SAA1435)

Product name ARO-A15374-100
Uniprot ID O95750
Raw Antigen Sequence MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Reference ARO-A15374
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen FGF19,Fibroblast growth factor 19,FGF-19
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15374-1MG
Uniprot ID O95750
Raw Antigen Sequence MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Reference ARO-A15374
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen FGF19,Fibroblast growth factor 19,FGF-19
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15374-50
Uniprot ID O95750
Raw Antigen Sequence MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Reference ARO-A15374
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen FGF19,Fibroblast growth factor 19,FGF-19
Target species Anti-Human Monoclonal Antibody

Anti-Human FGF19 Antibody (SAA1435) binds to Recombinant Human FGF19, N-His in WB Assay

Anti-Human FGF19 Antibody (SAA1435) binds to Recombinant Human FGF19, N-His in WB Assay

Recombinant Human FGF19, N-His(cat. No.ARO-P14225) can bind Anti-Human FGF19 Antibody (SAA1435) in Western Blot Assay as detected on gel analysis.

Flow Cytometry results for Anti-Human FGF19 Antibody (SAA1435)

Flow Cytometry results for Anti-Human FGF19 Antibody (SAA1435)

Flow-cytometry using anti-human FGF19 antibody.HT-29 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human FGF19 antibody monoclonal antibody (Catalog # ARO-A15374 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human FGF19 Antibody (SAA1435)

There are no reviews yet.

Be the first to review “Anti-Human FGF19 Antibody (SAA1435)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products