Brand: ProteoGenix

Anti-Human FGF19 Antibody (SAA1435)

ARO-A15374-50
Validated ELISA FC WB

Original price was: €325.00.Current price is: €239.00.

50ug 26% OFF + 239 loyalty points

Size Size

50ug Original price was: €325.00.Current price is: €239.00.
100ug Original price was: €410.00.Current price is: €342.00.
1MG Original price was: €1,309.00.Current price is: €992.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Anti-Human FGF19 Antibody (SAA1435) binds to Recombinant Human FGF19, N-His in WB Assay

Flow Cytometry results for Anti-Human FGF19 Antibody (SAA1435)

Datasheet

Anti-Human FGF19 Antibody (SAA1435)

Product name	ARO-A15374-100
Uniprot ID	O95750
Raw Antigen Sequence	MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Human
Reactivity	Human
Reference	ARO-A15374
Isotype	IgG1
Clonality	Monoclonal Antibody
Purification	Protein A or G purified from cell culture supernatant.
Immunogen	FGF19,Fibroblast growth factor 19,FGF-19
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15374-1MG
Uniprot ID	O95750
Raw Antigen Sequence	MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Human
Reactivity	Human
Reference	ARO-A15374
Isotype	IgG1
Clonality	Monoclonal Antibody
Purification	Protein A or G purified from cell culture supernatant.
Immunogen	FGF19,Fibroblast growth factor 19,FGF-19
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15374-50
Uniprot ID	O95750
Raw Antigen Sequence	MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Human
Reactivity	Human
Reference	ARO-A15374
Isotype	IgG1
Clonality	Monoclonal Antibody
Purification	Protein A or G purified from cell culture supernatant.
Immunogen	FGF19,Fibroblast growth factor 19,FGF-19
Target species	Anti-Human Monoclonal Antibody

Datasheet

Anti-Human FGF19 Antibody (SAA1435) binds to Recombinant Human FGF19, N-His in WB Assay

Recombinant Human FGF19, N-His(cat. No.ARO-P14225) can bind Anti-Human FGF19 Antibody (SAA1435) in Western Blot Assay as detected on gel analysis.

Flow Cytometry results for Anti-Human FGF19 Antibody (SAA1435)

Target Cells were stained with an irrelevant antibody or Anti-Human FGF19 Antibody (SAA1435) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.