Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human EXOSC3 Polyclonal Antibody

  • ARO-A11816-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: €142.00.Current price is: €118.00.

50ug 17% OFF + 118 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human EXOSC3 Polyclonal Antibody

Product name ARO-A11816-100
Uniprot ID Q9NQT5
Raw Antigen Sequence KGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-EXOSC3, Exosome component 3, Exosome complex component RRP40, RRP40, Ribosomal RNA-processing protein 40, p10
Reference ARO-A11816
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human EXOSC3 (Lys113-Ser275).
Product name ARO-A11816-1MG
Uniprot ID Q9NQT5
Raw Antigen Sequence KGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-EXOSC3, Exosome component 3, Exosome complex component RRP40, RRP40, Ribosomal RNA-processing protein 40, p10
Reference ARO-A11816
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human EXOSC3 (Lys113-Ser275).
Product name ARO-A11816-50
Uniprot ID Q9NQT5
Raw Antigen Sequence KGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-EXOSC3, Exosome component 3, Exosome complex component RRP40, RRP40, Ribosomal RNA-processing protein 40, p10
Reference ARO-A11816
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human EXOSC3 (Lys113-Ser275).

There are no reviews yet.

Be the first to review “Anti-Human EXOSC3 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products