Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CXCL13/BCA-1/BLC Antibody (SAA0468)

  • ARO-A15490-50
  • Validated ELISA WB

Original price was: €327.00.Current price is: €239.00.

50ug 27% OFF + 239 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CXCL13/BCA-1/BLC Antibody (SAA0468)

Product name ARO-A15490-100
Uniprot ID O43927
Raw Antigen Sequence MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15490
Isotype IgG2a, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CXCL13/BCA-1/BLC
Clone Name SAA0468
Protein Name CXCL13/BCA-1/BLC
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15490-1MG
Uniprot ID O43927
Raw Antigen Sequence MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15490
Isotype IgG2a, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CXCL13/BCA-1/BLC
Clone Name SAA0468
Protein Name CXCL13/BCA-1/BLC
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15490-50
Uniprot ID O43927
Raw Antigen Sequence MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15490
Isotype IgG2a, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CXCL13/BCA-1/BLC
Clone Name SAA0468
Protein Name CXCL13/BCA-1/BLC
Target species Anti-Human Monoclonal Antibody

Anti-Human CXCL13/BCA-1/BLC Antibody (SAA0468) binds to CXCL13 / BCA-1 / BLC, N-His, recombinant protein in WB Assay

Anti-Human CXCL13/BCA-1/BLC Antibody (SAA0468) binds to CXCL13 / BCA-1 / BLC, N-His, recombinant protein in WB Assay

CXCL13 / BCA-1 / BLC, N-His, recombinant protein(cat. No.PX-P5678) can bind Anti-Human CXCL13/BCA-1/BLC Antibody (SAA0468) in Western Blot Assay as detected on gel analysis.

Anti-Human CXCL13/BCA-1/BLC Antibody (SAA0468) binds to CXCL13 / BCA-1 / BLC, N-His, recombinant protein in ELISA Assay

Anti-Human CXCL13/BCA-1/BLC Antibody (SAA0468) binds to CXCL13 / BCA-1 / BLC, N-His, recombinant protein in ELISA Assay

CXCL13 / BCA-1 / BLC, N-His, recombinant protein(cat. No.PX-P5678) at 0.5µg/mL (100µL/well) can bind Anti-Human CXCL13/BCA-1/BLC Antibody (SAA0468) in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Human CXCL13/BCA-1/BLC Antibody (SAA0468)

There are no reviews yet.

Be the first to review “Anti-Human CXCL13/BCA-1/BLC Antibody (SAA0468)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products