Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human CTSB Monoclonal Antibody (2A2)

  • PTX25184-50
  • Validated FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG2a, kappa

Original price was: €363.00.Current price is: €265.00.

50ug 27% OFF + 265 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human CTSB Monoclonal Antibody (2A2) binds to Human CTSB Recombinant Protein, C-His in WB Assay
SDS-PAGE for Anti-Human CTSB Monoclonal Antibody (2A2)
Flow Cytometry results for Anti-Human CTSB Monoclonal Antibody (2A2)

Anti-Human CTSB Monoclonal Antibody (2A2)

Product name PTX25184-100
Uniprot ID P07858
Raw Antigen Sequence MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CTSB
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name CTSB
Product name PTX25184-1MG
Uniprot ID P07858
Raw Antigen Sequence MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CTSB
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name CTSB
Product name PTX25184-50
Uniprot ID P07858
Raw Antigen Sequence MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CTSB
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name CTSB

Anti-Human CTSB Monoclonal Antibody (2A2) binds to Human CTSB Recombinant Protein, C-His in WB Assay

Anti-Human CTSB Monoclonal Antibody (2A2) binds to Human CTSB Recombinant Protein, C-His in WB Assay

Human CTSB Recombinant Protein, C-His(cat. No.ARO-P18128) can bind Anti-Human CTSB Monoclonal Antibody (2A2) in Western Blot Assay as detected on gel analysis.

SDS-PAGE for Anti-Human CTSB Monoclonal Antibody (2A2)

SDS-PAGE for Anti-Human CTSB Monoclonal Antibody (2A2)

Anti-Human CTSB Monoclonal Antibody (2A2), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Anti-Human CTSB Monoclonal Antibody (2A2)

Flow Cytometry results for Anti-Human CTSB Monoclonal Antibody (2A2)

Flow-cytometry using FITC anti-human CTSB antibody. HepG-2 cells were fixed and permeabilized, then stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human CTSB monoclonal antibody (Catalog: PTX25184, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human CTSB Monoclonal Antibody (2A2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products