Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD90/THY1 Antibody (H5), APC

  • ARO-A10364-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG1, kappa
Target species:
Human
Clone Name:
H5

Original price was: €211.00.Current price is: €176.00.

50ug 17% OFF + 176 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD90/THY1 Antibody (H5), APC

Product name ARO-A10364-100
Uniprot ID P04216
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference ARO-A10364
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Clone Name H5
Target species Human
Product name ARO-A10364-1MG
Uniprot ID P04216
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference ARO-A10364
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Clone Name H5
Target species Human
Product name ARO-A10364-50
Uniprot ID P04216
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference ARO-A10364
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Clone Name H5
Target species Human

Flow Cytometry results for Anti-Human CD90/THY1 Antibody (H5), APC

Flow Cytometry results for Anti-Human CD90/THY1 Antibody (H5), APC

Flow-cytometry using APC anti-human CD90 antibody. Jurkat cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human CD90 monoclonal antibody (Catalog: ARO-A10364, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human CD90/THY1 Antibody (H5), APC”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Isotype
All
Target Species
All
Applications
All

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products