Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD7 VHH (SAA1260)

Note:
For research use only. Not suitable for human use.

Original price was: €517.00.Current price is: €380.00.

100ug 26% OFF + 380 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD7 VHH (SAA1260)

Product name ARO-A16429-100
Uniprot ID P09564
Raw Antigen Sequence MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-GP40, anti-CD7, anti-T-cell surface antigen Leu-9, anti-T-cell leukemia antigen, anti-TP41, anti-T-cell antigen CD7
Reference ARO-A16429
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD7
Clone Name SAA1260
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16429-1MG
Uniprot ID P09564
Raw Antigen Sequence MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-GP40, anti-CD7, anti-T-cell surface antigen Leu-9, anti-T-cell leukemia antigen, anti-TP41, anti-T-cell antigen CD7
Reference ARO-A16429
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD7
Clone Name SAA1260
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16429-50
Uniprot ID P09564
Raw Antigen Sequence MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-GP40, anti-CD7, anti-T-cell surface antigen Leu-9, anti-T-cell leukemia antigen, anti-TP41, anti-T-cell antigen CD7
Reference ARO-A16429
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD7
Clone Name SAA1260
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human CD7 VHH (SAA1260)

SDS-PAGE for Anti-Human CD7 VHH (SAA1260)

Anti-Human CD7 VHH (SAA1260), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human CD7 VHH (SAA1260)

There are no reviews yet.

Be the first to review “Anti-Human CD7 VHH (SAA1260)”

Your email address will not be published. Required fields are marked *

Related products

  • 5′-nucleotidase(NT5E)
    Original price was: €327.00.Current price is: €275.00.
    View Product

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products